Sequence of DPV Soybean yellow mottle mosaic virus

Soybean yellow mottle mosaic virus strain MS1, complete genome.

ACC No: FJ707484

Dated: 2010-09-07 | Length: 4009 | CRC: 1224469911

                
ID   FJ707484; SV 1; linear; genomic RNA; STD; VRL; 4009 BP.
XX
AC   FJ707484;
XX
DT   11-MAR-2009 (Rel. 100, Created)
DT   07-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Soybean yellow mottle mosaic virus strain MS1, complete genome.
XX
KW   .
XX
OS   Soybean yellow mottle mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4009
RX   AGRICOLA; IND44291600.
RX   DOI; 10.1094/PDIS-93-11-1214B.
RA   Li S., Moon J.S., Lee S.H., Domier L.L.;
RT   "First Report of Soybean yellow mottle mosaic virus in soybean in North
RT   America";
RL   Plant Dis. 93(11):1214-1214(2009).
XX
RN   [2]
RP   1-4009
RA   Li S., Moon J.S., Lee S.H., Domier L.L.;
RT   ;
RL   Submitted (04-FEB-2009) to the EMBL/GenBank/DDBJ databases.
RL   Dept. Crop Sci., Univ of Illinois, USDA-ARS, 1102 S. Goodwin Ave., Urbana,
RL   IL 61801, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4009
FT                   /organism="Soybean yellow mottle mosaic virus"
FT                   /host="Glycine max (soybean)"
FT                   /strain="MS1"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="18-Aug-2008"
FT                   /note="acronym: SYMMMV"
FT                   /db_xref="taxon:578361"
FT   CDS             40. .2667
FT                   /codon_start=1
FT                   /transl_except=(pos:721. .723,aa:OTHER)
FT                   /transl_except=(pos:2278. .2280,aa:OTHER)
FT                   /product="P82"
FT                   /note="replication-associated protein"
FT                   /db_xref="GOA:C0LF85"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:C0LF85"
FT                   /protein_id="ACN59473.1"
FT                   /translation="MMIQFGTMPPVRIDGPPRAFSMGMALRAVGKFLVNCCSAFGDNWA
FT                   DSITRNRTQHVCALQYFGDLPIECIVKSTGDFAREPANVTREVGNEKRVVNRHAKGYFL
FT                   SEMVASCRLHFNGIPRSTEANLLGVRRYLATYCQEHRLTNQQTLKLVDVATPLVMTANH
FT                   QDVVSMKLMNDPLLNLYRTLHLEAQVVHTPLRQLVARPFSGTAWSQWIDSVRGYRDPRG
FT                   FRLAQXGCLRRVPGFNTKISRGDHPDMQITPRNGCHKVRYMGQVLGMSNGKHFGVHNSS
FT                   LTNLRRGLIERVFYVEGPKGLQPPPKPEPGIFQESLHGFKRKLMHVVGTHSRIGHDEFV
FT                   SLYHGRRRTIYQQAVDSLSVRSVERKDAYLSTFIKAEKIPLWKKPDPAPRVIQPRNPRY
FT                   NVEVGCYLRKFEHHLYRGIDSIMGGPTVIKGYDVDQIGGIMEEAWNKFSDPVAIGFDMS
FT                   RFDQHVSEDALRFEHSVYLQHFNQDPNLARLLSWQIDNKGYANLAEGKVRYKRRGCRMS
FT                   GDMNTALGNCLLACAITWKLMSGLKFRLLNNGDDCVVITDKSNERAVCERLKHFTRYGF
FT                   TCIAEKPVYELEHLEFCNLQPLNLGSHYTAVRKPTVSLSKDTFCVSGWNNEIDAANWLN
FT                   AIGQCGLALSAGVPVLQSYYSALTRNFPNGKWLSKNCGKLDSGFYRLALHTMGRKPVQV
FT                   SEVARFSFYVMTGVTPDAQVAVEKLYDNLIINRSFEPEGNAKPELDNLSSLIXWTNLPK
FT                   GDAAEAGAGKHKGQRDLSQRISRFKLPTMPSTRHEVNHLAVITGVILLLWHIRSQSILI
FT                   LIFDVIAPRVTNITSAILLAIFYCYSNSTASIPYISQPVTHSSTSKIVYIAVGTNPVSV
FT                   SKHE"
FT   CDS             40. .723
FT                   /codon_start=1
FT                   /product="P26"
FT                   /note="replication-associated protein"
FT                   /db_xref="UniProtKB/TrEMBL:C0LF86"
FT                   /protein_id="ACN59472.1"
FT                   /translation="MMIQFGTMPPVRIDGPPRAFSMGMALRAVGKFLVNCCSAFGDNWA
FT                   DSITRNRTQHVCALQYFGDLPIECIVKSTGDFAREPANVTREVGNEKRVVNRHAKGYFL
FT                   SEMVASCRLHFNGIPRSTEANLLGVRRYLATYCQEHRLTNQQTLKLVDVATPLVMTANH
FT                   QDVVSMKLMNDPLLNLYRTLHLEAQVVHTPLRQLVARPFSGTAWSQWIDSVRGYRDPRG
FT                   FRLAQ"
FT   CDS             2280. .2486
FT                   /codon_start=1
FT                   /product="P7"
FT                   /db_xref="GOA:C0LF87"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C0LF87"
FT                   /protein_id="ACN59474.1"
FT                   /translation="MDKSPQRGRSRSRSRQTQGPKGPKPENKQIQVAHHAVDKTRGKPP
FT                   GGDHGGDFVIVAHTVTVNINFNI"
FT   CDS             2383. .2667
FT                   /codon_start=1
FT                   /product="P10"
FT                   /db_xref="UniProtKB/TrEMBL:C0LF88"
FT                   /protein_id="ACN59477.1"
FT                   /translation="MPSTRHEVNHLAVITGVILLLWHIRSQSILILIFDVIAPRVTNIT
FT                   SAILLAIFYCYSNSTASIPYISQPVTHSSTSKIVYIAVGTNPVSVSKHE"
FT   CDS             2664. .3728
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:C0LF89"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C0LF89"
FT                   /protein_id="ACN59476.1"
FT                   /translation="MNGKMLTIAQLAKKEKTEGRRALSKNQRKRLDSADTRPLKEVSST
FT                   ARVSTRRVPAAISSNVSNGVPNYAVRQNKPVIQHTELWGTLMSNSTESPAYIARTLNPS
FT                   DPATFNWVQPLSTGYDMYRLINCEIIYTPRCATTTTGSVVLAHDPDASDANPDNVTDLL
FT                   NMAGAVSGSVFSPLRIKPNIKQLDRYVRDNSTSDPKLVDAGKILVAAYGQQASTTPFAL
FT                   GEVRFSYTLQLLNPQPHSTMVQRLGAAPPPGVGPTYATLRTVNGATTSSNVLTFSTAGA
FT                   YLITAVDATAGLGTPVTTDFGRFRVQGTSAADSPLLMFGTALKSGATISFSGPVSNVLD
FT                   VYVVRDSGVSDNSS"
FT   CDS             2668. .3339
FT                   /codon_start=1
FT                   /product="P25"
FT                   /db_xref="UniProtKB/TrEMBL:C0LF90"
FT                   /protein_id="ACN59475.1"
FT                   /translation="MEKCSLSPNSPRRRKQRDEELSPRTSESDSTPPTLDPSRKSVAPP
FT                   ECQHEESPLPSRPMCPMEYRTTLFDKTNRSFSILSYGELLCLIALSPLLISLGHSTQVT
FT                   LQHSIGCNRSPQGMICTDSLIVRSSTLPGVRLPLRDRLSWRMIQTLVMLTLITSLTCLT
FT                   WLALSLARSSLPSGSSQTLNSSTVMFVTILLATPSWLMLARYWLQHMDSKLQQPPSPSV
FT                   K"
XX
SQ   Sequence 4009 BP; 1041 A; 1017 C; 1002 G; 949 T; 0 other;

fj707484 Length: 4009  07-SEP-2010  Type: N  Check: 6886  ..

       1  gggtaaccca gccagttatc caccatttaa tctttcagga tgatgatcca
      51  attcggaaca atgccacctg tcagaattga tggacctcca cgagcttttt
     101  cgatggggat ggctctcaga gcggttggga aattcttagt caactgttgc
     151  tctgctttcg gcgataactg ggccgacagc atcaccagga accggactca
     201  acacgtctgc gcactccagt attttgggga cctccccatt gagtgcatag
     251  tgaagagcac cggggacttt gcaagggaac cagccaatgt gaccagggaa
     301  gtcggaaatg aaaagcgtgt tgtcaatagg cacgccaaag ggtacttcct
     351  aagtgaaatg gtggcgagtt gccgattaca cttcaacggc attcctcgct
     401  ccactgaggc caatctccta ggagttaggc gctacctagc aacatattgc
     451  caggagcaca ggttgaccaa ccagcagaca ctgaagttgg tcgatgtcgc
     501  cacccccctt gtaatgactg ccaatcatca ggatgtggtt tccatgaagt
     551  taatgaatga cccgttactg aacttgtatc ggaccttaca tttggaagcc
     601  caggtggtgc acaccccact gcgacagctt gtcgcccgtc ccttctctgg
     651  gaccgcttgg agccagtgga tcgactccgt taggggttat agggacccga
     701  gagggttccg gctcgctcaa taggggtgcc taaggcgtgt gccagggttt
     751  aatactaaaa taagtcgtgg cgaccaccct gacatgcaga tcacgcctag
     801  gaacggatgc cacaaggtaa ggtacatggg ccaggtttta gggatgtcca
     851  acgggaagca ctttggagta cacaactcca gtctaaccaa ccttcggaga
     901  ggtttgatcg agagggtgtt ctacgttgaa ggacccaaag ggctacagcc
     951  cccacccaaa ccagagcccg gtatcttcca agagtcttta cacggtttca
    1001  aacgcaagct gatgcatgtg gtcggcactc attccaggat cggacatgat
    1051  gaatttgtgt ccttgtatca tggcaggagg aggaccatat accagcaggc
    1101  ggttgattcc ctttctgtga gatctgtaga gaggaaggat gcttatttga
    1151  gtactttcat caaagcagag aagatcccgc tttggaagaa gccagaccca
    1201  gctccccgag taatccagcc gcgaaatcca agatacaacg tggaagttgg
    1251  gtgctatttg agaaaatttg aacaccactt gtacagaggg atagactcaa
    1301  tcatgggtgg acccactgta atcaagggct acgatgtgga ccagatcggt
    1351  ggcataatgg aagaagcatg gaacaaattc tccgacccgg tcgcaatcgg
    1401  gtttgacatg agtcgcttcg accaacatgt ttccgaggac gctttgcggt
    1451  ttgaacatag tgtgtacttg cagcatttca accaagaccc taatttagca
    1501  aggctattgt catggcagat tgacaacaaa ggatacgcca atctggctga
    1551  agggaaagtg aggtacaaac gaagagggtg tagaatgagt ggtgacatga
    1601  acactgcctt gggcaattgt ctattggcat gtgccatcac gtggaaactc
    1651  atgtctgggc tgaagttccg gttactaaac aacggtgacg attgtgttgt
    1701  tataacagat aaatcgaatg agagagccgt ttgcgaaaga ctgaagcact
    1751  tcacccgata tggattcacg tgcatcgccg aaaagcccgt atacgaacta
    1801  gagcatctcg agttctgcaa ccttcaacct ttgaaccttg ggagtcacta
    1851  cacagcagtg cgtaagccta cagtcagtct atcaaaggac accttttgcg
    1901  tgtcagggtg gaacaatgaa attgatgcag caaactggtt gaatgctatt
    1951  ggacagtgtg gacttgcact gtcagccgga gtgccagtgc tacagagcta
    2001  ttattccgca ttgacccgga actttccaaa tggtaaatgg ctttctaaga
    2051  attgtgggaa attggatagt gggttttacc gcctagcgtt acatacgatg
    2101  ggccggaagc cggttcaggt tagtgaggtt gctaggttct ccttctatgt
    2151  gatgactggg gtcacccctg acgcccaggt ggctgtggag aaactgtatg
    2201  acaacctgat tataaatcgt tcattcgaac cggagggtaa cgccaagccc
    2251  gaacttgata atttatcttc tctcatataa tggacaaatc tccccaaagg
    2301  ggacgcagca gaagcaggag ccggcaaaca caagggccaa agggacctaa
    2351  gccagagaat aagcagattc aagttgccca ccatgccgtc gacaagacac
    2401  gaggtaaacc acctggcggt gatcacgggg gtgattttgt tattgtggca
    2451  catacggtca cagtcaatat taattttaat atttgacgta atcgccccta
    2501  gggtaacaaa cataacatct gccattcttc tagccatttt ctattgctat
    2551  tccaattcta ctgcaagcat tccttacatt tctcagcctg taacacactc
    2601  tagcacgtct aagatagttt atatagccgt tgggacaaat cctgtttcag
    2651  tcagtaagca cgaatgaatg gaaaaatgct cactatcgcc caactcgcca
    2701  agaaggagaa aacagaggga cgaagagctc tctccaagaa ccagcgaaag
    2751  cgactcgact ccgccgacac tcgacccctc aaggaagtca gtagcaccgc
    2801  cagagtgtca acacgaagag tccccgctgc catctcgtcc aatgtgtcca
    2851  atggagtacc gaactacgct gttcgacaaa acaaaccggt cattcagcat
    2901  actgagttat ggggaactct tatgtctaat agcactgagt cccctgctta
    2951  tatcgctcgg acactcaacc caagtgaccc tgcaacattc aattgggtgc
    3001  aaccgctctc cacagggtat gatatgtaca gactcattaa ttgtgagatc
    3051  atctacactc ccaggtgtgc gactaccact acgggatcgg ttgtcttggc
    3101  gcatgatcca gacgctagtg atgctaaccc tgataacgtc actgacctgc
    3151  ttaacatggc tggcgctgtc tctggctcgg tcttctctcc cctcaggatc
    3201  aagccaaaca ttaaacagct cgaccgttat gttcgtgaca attctactag
    3251  cgaccccaag ctggttgatg ctggcaagat attggttgca gcatatggac
    3301  agcaagcttc aacaaccccc ttcgccctcg gtgaagtgag gttttcatac
    3351  acgctccagc tgctcaaccc tcagccacat tcaactatgg tgcaacgact
    3401  cggggctgcc ccacctcctg gggtcggccc cacttacgca accctgcgta
    3451  cagttaatgg tgccaccaca tccagcaacg ttctcacatt ttcgactgct
    3501  ggcgcctacc ttatcactgc cgttgacgct acagctgggc ttggaacccc
    3551  ggtcaccact gatttcggtc ggttccgcgt acagggcact agtgctgctg
    3601  actccccact actgatgttc ggcacagctc tcaagagtgg ggctaccatc
    3651  tcttttagcg ggcctgtctc caacgttttg gatgtttatg ttgtgcgcga
    3701  tagcggagtt agcgacaact ccagctagag cttgtaaatt tatatctttc
    3751  tgaaaacccc tcacacaatc cctttacctc gatggggcca gcgtctgtca
    3801  ctaggcagca tggcgaaccg acgttctagg gtaaggttgg cacctgcgtg
    3851  ttagggaccc aaaaatagag tgaaattagt gtgtgtctcc cacattcgtg
    3901  ggcggttgca agagccgacg taacgtatct agccagaaat ccttcgggtg
    3951  gggtggttag aaacagcaaa tcttgacctg ataggccccg ggcatgcggg
    4001  gcccccccc