Sequence of DPV Angelonia flower break virus

Angelonia flower break virus CP gene for coat protein, strain California, genomic RNA

ACC No: FR775892

Dated: 2011-01-24 | Length: 1056 | CRC: 205308794

                
ID   FR775892; SV 1; linear; genomic RNA; STD; VRL; 1056 BP.
XX
AC   FR775892;
XX
DT   24-JAN-2011 (Rel. 107, Created)
DT   24-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Angelonia flower break virus CP gene for coat protein, strain California,
DE   genomic RNA
XX
KW   .
XX
OS   Angelonia flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1056
RA   Mathews D.M.;
RT   ;
RL   Submitted (18-JAN-2011) to the EMBL/GenBank/DDBJ databases.
RL   Mathews D.M., University of California, Plant Pathology and Microbiology,
RL   900 University Ave, Riverside, CA, 92521, USA.
XX
RN   [2]
RA   Verma N., Mathews D.M.;
RT   "Characterization of a California isolate of Angelonia flower break virus";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1056
FT                   /organism="Angelonia flower break virus"
FT                   /strain="California"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:California"
FT                   /isolation_source="Angelonia sp."
FT                   /collected_by="Neeraj Verma"
FT                   /db_xref="taxon:352882"
FT   CDS             1. .1056
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CBY94063.1"
FT                   /translation="MSNLRNDPRVAKLAAQGSAWAKRLMNNGWGGLRPNQKAAARQALG
FT                   ILPAPVATPVTTTRLVNGNPTNQRRKRGQPGNLRTDTPVTSTEFFADVLLHTGEDANIR
FT                   SWVVNPREVSLFPRLSIQSALYDKYRISSLRVRFASSCSFEVNGKIMLGFIGDSSDEVP
FT                   VTKIDVHSLTKTAECTAMQNIIFNVGGDNITRFLGDRASDDPKLVNFGRIVLCTYGFDS
FT                   NAPSIVGELSIEYTITLLNPSPVASLSQRWISGNSKGIRFVEYTHNVVTKTYQFVFRTG
FT                   GRYCLVVATDKGVFGSPLVTGSVQTQSRVVTDGTATLMTVSVDMKAPNGTISWIPPTDQ
FT                   GALTEWIVTRV"
XX
SQ   Sequence 1056 BP; 256 A; 308 C; 253 G; 239 T; 0 other;

fr775892 Length: 1056  24-JAN-2011  Type: N  Check: 3835  ..

       1  atgagcaatc tccgcaacga cccgcgagtc gcaaagcttg ccgcccaagg
      51  ctctgcctgg gccaagcgac tcatgaacaa tggttggggt gggcttcgac
     101  caaatcagaa agctgcagca cggcaagctc tggggatcct ccccgctcct
     151  gttgccactc ccgtaaccac cactaggttg gtcaacggta accccaccaa
     201  ccaaaggcgt aaacgtggtc aacctggcaa tctgcgtact gacacgccag
     251  tcaccagcac cgaattcttc gctgacgtac tgttacacac tggagaggac
     301  gcaaacatcc gctcgtgggt tgtcaatcct cgagaggtca gcctcttccc
     351  tcgactctct atccaatccg cattgtacga caagtaccgc atttcatctc
     401  tccgagttcg cttcgcttcc tcttgctcgt ttgaagtgaa cgggaagatc
     451  atgctcgggt tcattgggga ttcctctgat gaagtacccg tcacaaagat
     501  cgacgttcac tccctcacta aaacagcaga gtgcactgcc atgcagaaca
     551  ttatctttaa cgtgggagga gacaacatca cccgcttcct cggtgatagg
     601  gcgagcgacg acccaaaact tgtcaacttc ggccgcatcg tgctttgcac
     651  ttacggcttc gacagcaatg caccatccat cgtcggagag ttgtccattg
     701  agtacaccat tactctactc aatccgtccc ctgtcgctag tctatctcaa
     751  aggtggatta gcggcaactc caagggaatt cgattcgtgg agtacacaca
     801  caatgtggtg acgaaaactt accagttcgt cttccgaaca ggaggacggt
     851  actgccttgt tgttgccacg gacaaagggg tctttggatc tcccctcgta
     901  acaggctcag ttcaaacaca gtcgcgtgtg gtgactgatg gaaccgccac
     951  gctcatgacg gtatccgtag atatgaaagc acctaacggc accatcagtt
    1001  ggattccgcc aacagatcag ggtgcactta ctgagtggat tgtcactcgg
    1051  gtataa