Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate FUM2 polymerase-associated protein gene, partial cds.

ACC No: GU229740

Dated: 2009-12-23 | Length: 943 | CRC: -621175626

                
ID   GU229740; SV 1; linear; genomic RNA; STD; VRL; 943 BP.
XX
AC   GU229740;
XX
DT   23-DEC-2009 (Rel. 103, Created)
DT   23-DEC-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate FUM2 polymerase-associated protein gene,
DE   partial cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-943
RA   Sabokkhiz M.A., Jafarpour B., Falahati-Rastegar M., Pakbaz S.;
RT   ;
RL   Submitted (18-NOV-2009) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Ferdowsi University of Mashhad, Faculty of
RL   Agriculture, Mashhad, Khorasan Razavi, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .943
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="FUM2"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran:Khorasan Razavi"
FT                   /collection_date="Jan-2009"
FT                   /db_xref="taxon:11986"
FT   CDS             29. .>943
FT                   /codon_start=1
FT                   /transl_except=(pos:764. .766,aa:OTHER)
FT                   /product="polymerase-associated protein"
FT                   /note="read through stop codon"
FT                   /protein_id="ADA63842.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGKCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTRLIEVKAEVDGKE
FT                   VVVSKKRVVSRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYERKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPPKERKL
FT                   YVQNAITTGYEYRVHNHSYANLRR"
XX
SQ   Sequence 943 BP; 261 A; 197 C; 271 G; 214 T; 0 other;

gu229740 Length: 943  23-DEC-2009  Type: N  Check: 6838  ..

       1  ttatatattc taaccatctg ctttcactat gggattaccc agtctactag
      51  tggaaggcgt tattggatgc actctagtcg gtggtctggt ggctgtgggt
     101  agcgcagcgc tagccgttcg ggcaaccatc ggcgttgtag aattcaatag
     151  ggagtgtgtg cgcggggcga gaaggatcgt atctagcgga ggaaagtgct
     201  taatagtcca atccccttat ggtaatccta accaaggatt aataaggggt
     251  gaagacgaag aaattgacaa tgtggaagag tcaacaccgg aggaattgac
     301  tcggttgatt gaggttaagg cggaagtgga tgggaaagag gtggtcgtct
     351  ccaagaagcg cgtggtaagc aggcacttga gacaacgatt cgttcgctcc
     401  atagccatcg aagccaaaaa tcactttggt ggtgacatca gccctagcaa
     451  ggccaactac ctttccgttt ccaagtttct gacggggaaa tgcaaggaga
     501  gacatgttgt gcccgcccac actagagatt gtgtgagtgc tgctatggtg
     551  ctggtattca cccccgacgt ccacgagatc aggatgatgg caggattggc
     601  atctgacgca gcgtacgaaa ggaaaattgc aatggcaagc atactgaaca
     651  ggaaaggatg gtgttggagg ctaatggtaa atccattaga tagggcaaga
     701  tggtgggaaa tgtggtgcgt tgtaaacggg tttgactcca acaaacccgt
     751  cacctttccc aaataggggg gcctgttcta cctcaatggt gtggagacga
     801  aaattcgtcg tggaggccac ccatcagtga ttgaggtaga cgggcaatgt
     851  cctcccaaag agagaaaact ctacgtacag aatgccataa ccactggtta
     901  tgaatacagg gtccacaacc attcgtacgc aaacctcaga cga