Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate MNSV-HM, complete genome.

ACC No: GU480022

Dated: 2010-03-08 | Length: 4267 | CRC: 599847852

                
ID   GU480022; SV 1; linear; genomic RNA; STD; VRL; 4267 BP.
XX
AC   GU480022;
XX
DT   08-MAR-2010 (Rel. 104, Created)
DT   08-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Melon necrotic spot virus isolate MNSV-HM, complete genome.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4267
RA   Wu H.J., Gu Q.S., Tian Y.P., Wen S.H.;
RT   ;
RL   Submitted (19-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Biotechnology Centre, Zhengzhou Fruit Institute, The Chinese Academy of
RL   Agricultural Sciences, South of East Hanghai Road, Zhengzhou, Henan 450009,
RL   China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4267
FT                   /organism="Melon necrotic spot virus"
FT                   /host="Cucumis melo L. (melon)"
FT                   /isolate="MNSV-HM"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Apr-2007"
FT                   /db_xref="taxon:11987"
FT   CDS             89. .2464
FT                   /codon_start=1
FT                   /transl_except=(pos:893. .895,aa:OTHER)
FT                   /product="89K protein"
FT                   /note="putative RNA-dependent RNA polymerase; replicase;
FT                   produced by a readthrough of the amber codon"
FT                   /protein_id="ADD17683.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAVVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLNGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGAFDRLAWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALRWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEIFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             89. .895
FT                   /codon_start=1
FT                   /product="29K protein"
FT                   /protein_id="ADD17681.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAVVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLNGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2443. .2829
FT                   /codon_start=1
FT                   /transl_except=(pos:2638. .2640,aa:OTHER)
FT                   /product="14K protein"
FT                   /note="produced by a readthrough of the amber codon at
FT                   2638-2640"
FT                   /protein_id="ADD17680.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAIAESKQG
FT                   VMGASTYIADKIKVTINFNFXCMACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGN
FT                   TYVHHFDNSSVKTQYVGISTNGDG"
FT   CDS             2443. .2640
FT                   /codon_start=1
FT                   /product="7K protein"
FT                   /protein_id="ADD17679.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAIAESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2816. .3988
FT                   /codon_start=1
FT                   /product="42K protein"
FT                   /note="coat protein"
FT                   /protein_id="ADD17682.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLANPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPANDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGSTAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4267 BP; 1077 A; 894 C; 1062 G; 1234 T; 0 other;

gu480022 Length: 4267  08-MAR-2010  Type: N  Check: 205  ..

       1  ggattactct agccggatcc ccgactctct tatttctcgt gagttagttc
      51  gtgtattgat tatctgtctt aatcagtata ggttagcaat ggatactggt
     101  ttgaaatttc ttgtttctgg aggtttagcc acctcgtctg ttatcaggaa
     151  agtgagtgct gtgagttcat tggattcgtc cctcccttca tcatctatat
     201  tatctgccat tcatgggtct tggactagtg ctatcagcca cgattgtagt
     251  aaaattgcca aggttgccgc cgtggttgga attggttatc ttggggttag
     301  gattggtgcc gcttggtgcc gtcgtactcc cgggataacg aattccataa
     351  tcacctatgg ggaagaagtg gttgagcaag taaaggtaga tattgatgag
     401  gatgctgaag aggagtccga tactggtgag gaaattgtgg ttggcacgat
     451  aggtattggt atacatacaa acgtcaaccc tgaagttcga gctaagcgca
     501  gacatagatc gaggccattc atcaagaaga tcgtaaattt gactaagaat
     551  cacttcggtg gatgtcccga ctcaagtaaa tcgaacgtca tggctgtaag
     601  caaatttgtt tatgaacaat gtaaacagca caattgtctt ccacatcaaa
     651  cgagattgat catgagtatt gcagttccat tggtgctaag tcccgatatg
     701  tacgacattt ccagtaaagc tctgctaaac agcgagatat tgacagaaaa
     751  cagagccacg ctggaccgcc tcaaaactct taatgggtgg ctatcacact
     801  tggtgtgcca tccccttagc gcgaaagcct ggaggcgggc aattgacaac
     851  ttgtgtggtc ttccagattg gaaggctttc aagttggtca actaggggtg
     901  cctagaggag ctcgctgggt tctgtacttc ggtacggaga gggacacacc
     951  cagacatgac cgagtttcct caggatcgtc ccattaagac acgcaaactg
    1001  tattgtttag ggggagttgg gactagcgtg aagttcaacg tgcacaataa
    1051  ctctctagct aaccttcggc gcggtctaat tgagcgcgtt ttcttcgttg
    1101  aaaatgataa gaaggaacta gagcctgccc ctaaacctct tagtggtgcg
    1151  tttgaccgct tagcctggtt tcgtcggaaa ctccacaata ttgtgggtac
    1201  tcattccagt attagtccag gtcaattctt ggacttctat actggcagga
    1251  ggcgcacgat ttatgaaggt gctgtgaaat cgttggaggg gttaagtgtt
    1301  caacgaagag atgcctatct gaagacgttt gttaaagcgg agaagattaa
    1351  taccactaag aagcctgacc cagctccgcg ggttatacaa ccgaggaacg
    1401  taagatataa cgttgaggtt ggtcgttatc tacgtaggtt tgagcattac
    1451  ctctatcgag gaattgacga aatctggaat ggccccacca taattaaagg
    1501  gtacactgtc gagcaaattg ggaaaatcgc ccgtgatgct tgggactctt
    1551  ttgtaagtcc tgtagcaatc gggtttgaca tgaaaaggtt cgaccaacat
    1601  gtatcctccg acgctcttag atgggaacat agtgtttatc ttgatgcttt
    1651  ttgccacgac tcttatcttg cagaattatt agagtggcaa ttagttaata
    1701  agggcgtcgg gtatgccagt gatggaatga tcaaatataa ggttgatggg
    1751  tgccggatga gtggtgacat gaatacagct atgggtaact gtctgattgc
    1801  ttgtgccatc acacatgatt tcttccgtag tcgtggtatc agggcgcgtt
    1851  tgatgaacaa tggggatgac tgtgtcgtaa tatgcgaaaa agaatgtgcc
    1901  gcggtggtta aagccgacat ggtaaggcac tggagacaat tcgggtttca
    1951  atgcgaactc gagtgtgacg cagaaatctt cgagcaaatt gagttttgtc
    2001  aaatgcggcc tgtgtatgac ggggagaaat atgtgatggt gcggaatccg
    2051  ttggttagtc tatctaaaga ttcctactca gtcggccctt ggaatggaat
    2101  caaccatgca cgcaagtggg tgaacgcagt tggcttgtgt ggcttatccc
    2151  tcactggtgg aattcctgtt gtccagagtt attataatat gatgattcgc
    2201  aacacccaat ccgtgaacag ttctggcata cttcgcgatg tcagttttgc
    2251  cagtggattt cgggagctag cacgattggg taacaggaaa agtggtgcca
    2301  tatctgaaga cgcccgtttt agcttttatc tcgcatttgg cattactcca
    2351  gatttacaac gtgccatgga aagtgactat gatgctcata ccatagagtg
    2401  gggtttcgtg ccccagggaa atcctagaat acagccaatc tcatggactc
    2451  tcaacgaact gtagaacaaa ctaatcctcg gggaagaagt aaagaacgtg
    2501  gtgacagcgg gggaaaacaa aagaactcaa tggggcgaaa gatagccaat
    2551  gacgctatcg ctgaatcgaa gcaaggagtt atgggtgcta gcacatacat
    2601  tgctgataaa attaaggtga ccattaactt taatttttag tgtatggcct
    2651  gttatcgttg tgactccagc cccggggatt actccggagc attgcttata
    2701  ttatttatct catttgtttt cttttatatt acctcgctta gcccgcaagg
    2751  aaatacttac gttcatcact tcgataattc ttccgttaaa acacaatacg
    2801  ttggcatctc tacaaatggc gatggttaaa cgcattaata atctaccaac
    2851  agtgaagctc gctaagcagg ctctacctct gctagcgaat cctaaaattg
    2901  taaataaggc tatagatgtg gttcctttgg tcgttcaagg tggtcagaaa
    2951  ttgtctaagg ctgctaagcg actgcttggc gcttatgggg gcaacatttc
    3001  gtacactgag ggtgccaagc caggtgcaat atcagctcca gtcgccatca
    3051  gtcggcgagt ggctggtatg aagcctaggt ttgtccgatc agaaggatct
    3101  gtgaagatag ttcataggga gtttattgcc tctgttcttc ccgcaaatga
    3151  tctcaccgtt aataatggtg acgtcaatgt tggtaagtat agagtcaatc
    3201  ccagcaataa cgctttattt acatggcttc agggacaagc acaattatat
    3251  gatatgtaca gatttactcg gctccgtttc acctatattc caactaccgg
    3301  atctacttcc actggtcgtg tctctatcct ttgggataga gattcacaag
    3351  accccctccc cattgatcgt gctgccatta gctcttatgc tcattacgct
    3401  gactcagcgc cttgggctga gaatgtccta gtggttccgt gtgacaatac
    3451  gtggaggtac atgaatgata ctaatgctgt cgaccggaag ttggttgatt
    3501  ttgggcagtt tctctttgca acttattctg gtgctggtag caccgcccat
    3551  ggtgaccttt acgttgagta tgctgtggaa ttcaaggatc cccagcctat
    3601  cgctgggatg gtttgcatgt ttgatcgctt ggtctctttc tctgaagttg
    3651  gatccactat caagggagtc aattacattg ctgatcgtga tgtgataact
    3701  accgggggca atattggtgt taacatcaat attcccggga cttatcttgt
    3751  cacgattgta cttaatgcta catcaattgg ttccctcacc ttcactggta
    3801  actctaaact tgtaggcaat agtctcaatg ttaccagcag tggtgcatct
    3851  gctcttacgt ttacccttaa ctctacaggt gtgcccaaca gtagtaattc
    3901  ttcattctct gtgggtaccg tcgttgcatt gactagggta cgtatgacga
    3951  tcactcgctg ctctccggaa acagcctacc tcgcctaatt taatttactg
    4001  cactccaaat ctggtctcct tattcctacc tgttctcagc cagatctctg
    4051  ttctggtgtc ctatagacgt ccttgtcgtg tgtagtgcgg tctggctacc
    4101  cgtaacggcg tatcggcttg ggtcttcgat gattaggctc cggaatgtac
    4151  gacatagctg aagatggatg gagtttggta gatcaccgct agcaaaatac
    4201  actctgtgtg gggcgtgcta gtggatagtc atgtatgttt gagatgggtt
    4251  gtaggcccat cccgccc