Sequence of DPV Maize chlorotic mottle virus

Maize chlorotic mottle virus isolate MCMV-us coat protein gene, complete cds.

ACC No: GU594293

Dated: 2011-01-26 | Length: 711 | CRC: 1611947450

                
ID   GU594293; SV 1; linear; genomic RNA; STD; VRL; 711 BP.
XX
AC   GU594293;
XX
DT   24-MAR-2010 (Rel. 104, Created)
DT   26-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Maize chlorotic mottle virus isolate MCMV-us coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Maize chlorotic mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Machlomovirus.
XX
RN   [1]
RP   1-711
RX   PUBMED; 21073900.
RA   Zhang Y., Zhao W., Li M., Chen H., Zhu S., Fan Z.;
RT   "Real-time TaqMan RT-PCR for detection of maize chlorotic mottle virus in
RT   maize seeds";
RL   J. Virol. Methods 171(1):292-294(2011).
XX
RN   [2]
RP   1-711
RA   Zhang Y.J., Zhu S.F., Zhang Z.Y., Gong H.Y., Li G.F., Chen H.J.;
RT   "Detection and identification of Maize chlorotic mottle virus from imported
RT   maize seeds";
RL   Unpublished.
XX
RN   [3]
RP   1-711
RA   Zhang Y.J., Zhu S.F., Zhang Z.Y., Gong H.Y., Li G.F., Chen H.J.;
RT   ;
RL   Submitted (02-FEB-2010) to the EMBL/GenBank/DDBJ databases.
RL   Chinese Academy of Inspection and Quarantine, No. A3, Gaobeidian Beilu,
RL   Chaoyang District, Beijing 100025, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .711
FT                   /organism="Maize chlorotic mottle virus"
FT                   /host="Zea mays L."
FT                   /isolate="MCMV-us"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="Sep-2009"
FT                   /db_xref="taxon:12138"
FT   CDS             1. .711
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="CP"
FT                   /db_xref="GOA:D4P968"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:D4P968"
FT                   /protein_id="ADD84519.1"
FT                   /translation="MAASSRSTRGRKQRGRSVEAKSRAIRANPPVPRPNPQRNRPPPAG
FT                   TTCSMSEILLAVSATTADQILEIPVCAGIDFPAGTPPRYIGAAKWLAAQSQMWNTIVFN
FT                   SVRITWETFTADTTSGYISMAFLSDYMLSIPTGVEDVARIVPSATIALKNRGPSIVMPQ
FT                   NRTVFRCIQAGQFAALGSAADKQMYSPGRFIVAIPKASATQAVGQIKISYSVSYRGAAI
FT                   LQPALVPGPGLANH"
XX
SQ   Sequence 711 BP; 180 A; 208 C; 177 G; 146 T; 0 other;

gu594293 Length: 711  26-JAN-2011  Type: N  Check: 9194  ..

       1  atggcggcaa gtagccggtc tacccgaggt agaaagcagc gcggacgtag
      51  cgtggaagca aaatccagag ctattcgagc caacccgcct gtccctcgac
     101  ccaacccgca gcgaaaccgt cccccacctg cgggaacaac ctgctccatg
     151  tccgaaattc tgcttgcagt gtcagcaaca actgctgacc aaattctcga
     201  gattccagtg tgcgcaggga ttgacttccc agctggaacg ccaccccgat
     251  acattggggc ggccaaatgg ctggcagcac aatcacagat gtggaacaca
     301  attgtgttca actctgtgcg tatcacttgg gaaacattca cagcagacac
     351  cactagcgga tacatttcca tggcattcct ctctgattac atgctatcaa
     401  tacccactgg ggtggaggat gttgccagga tcgtgccctc agctacaata
     451  gctctgaaga acagagggcc gtccattgtt atgccacaaa accgcactgt
     501  gttcaggtgc atacaggctg gtcagtttgc tgcgttgggc agcgcggctg
     551  acaagcaaat gtattccccc ggacgattca ttgtggctat ccccaaagct
     601  agtgcaacac aagcggtagg ccaaatcaaa atctcgtact ccgtgtccta
     651  ccgtggagca gcaatcctac aacctgccct ggttccaggc ccagggctgg
     701  caaatcattg a