Sequence of DPV Unnamed TGP carmovirus 1

TGP Carmovirus 1 isolate 06TGP01091, complete genome.

ACC No: HM640935

Dated: 2011-09-07 | Length: 3929 | CRC: -1162654369

                
ID   HM640935; SV 2; linear; genomic RNA; STD; VRL; 3929 BP.
XX
AC   HM640935;
XX
DT   13-MAR-2011 (Rel. 108, Created)
DT   07-SEP-2011 (Rel. 110, Last updated, Version 5)
XX
DE   TGP Carmovirus 1 isolate 06TGP01091, complete genome.
XX
KW   .
XX
OS   TGP Carmovirus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3929
RX   PUBMED; 21762736.
RA   Scheets K., Blinkova O., Melcher U., Palmer M.W., Wiley G.B., Ding T.,
RA   Roe B.A.;
RT   "Detection of members of the Tombusviridae in the Tallgrass Prairie
RT   Preserve, Osage County, Oklahoma, USA";
RL   Virus Res. 160(1-2):256-263(2011).
XX
RN   [2]
RP   1-3929
RA   Scheets K., Blinkova O., Melcher U., Palmer M.W., Wiley G.B., Roe B.A.;
RT   ;
RL   Submitted (07-JUL-2010) to the INSDC.
RL   Biochemistry & Molecular Biology, Oklahoma State University, 246 NRC,
RL   Stillwater, OK 74078, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3929
RA   Scheets K., Blinkova O., Melcher U., Palmer M.W., Wiley G.B., Roe B.A.;
RT   ;
RL   Submitted (13-MAY-2011) to the INSDC.
RL   Biochemistry & Molecular Biology, Oklahoma State University, 246 NRC,
RL   Stillwater, OK 74078, USA
XX
CC   On May 13, 2011 this sequence version replaced gi:324984928.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3929
FT                   /organism="TGP Carmovirus 1"
FT                   /host="Lespedeza procumbens"
FT                   /isolate="06TGP01091"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Tallgrass Prairie Preserve, Oklahoma"
FT                   /lat_lon="36.83 N 96.39 W"
FT                   /isolation_source="upper leaves"
FT                   /collection_date="03-Jun-2006"
FT                   /db_xref="taxon:944580"
FT   CDS             27. .2339
FT                   /codon_start=1
FT                   /transl_except=(pos:771. .773,aa:Gln)
FT                   /product="putative RNA dependent RNA polymerase"
FT                   /db_xref="GOA:F1BA29"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:F1BA29"
FT                   /protein_id="ADY69093.2"
FT                   /translation="MFRDLCRYASQIVVGSTVLAVNVSVLSVAVQLRGAVAVYEVASKC
FT                   VTALEDCVSDLRDSLKPVPDELYNPSLCAALRMNNTDTELTAEDLLTTDRVLVNTWETD
FT                   EAKFKYRYKARIQSGQRGRFMYELVAYGKNHFGRAPRCCDSNYLSVTRLLVNRCNELHL
FT                   TPTQTRNVVAEAVSLVFIPDEEEIRQTMLTNSHYAYMQRTRQSVVSTVEPWWKELLLGP
FT                   SNAKNWRRAWIEICGLPEKQAISFAKQGCLWRTRGVTTNIFRAHHPDVTECHEANVHVR
FT                   DTYLYGARLTNGLKIGVHRNDFPNLRRGVMERVYYVENSETKQLQSPITPVDGIYRSMK
FT                   YIRLKLGGYIGLHSRTPMQKCVDMYKGRKRRTYQRAMDECKLEPFNPRWAHVKNFLKRE
FT                   KLNLSAKPDPAARIISPRDPRYNIHLACYLKPFEHHLYRAIDNLWGQPTVMKGYTVEEV
FT                   GQLFHRSWSAFRKPVAVGFDMKRFDQHVSVAALQFEHAVYLQAFGYDAHLQRMLSLQLN
FT                   NMCNAYCKNGKLRYNKMGTRMSGDLNTSCGNVLLACAITYDICKRIGLKAHLLNNGDDC
FT                   VLILESEDLPRVEILDTLWAEYGFVCIVEKPVFEIEEIEFCQMHPVFANSGYVMVRNPH
FT                   VSIAKDQHSLIPWTNVKVAKQCLKAIGECGSSLTSGIPMVHAFYQCLLRNTSDVRINPN
FT                   LREASAAAYFGMGGRTRGTHSISERTRYSFYLAFGITPDEQRAFEDDWERETIVWEWAP
FT                   DGFVAANHACLQLISQS"
FT   CDS             27. .773
FT                   /codon_start=1
FT                   /product="putative replication-associated protein"
FT                   /db_xref="UniProtKB/TrEMBL:F1BA30"
FT                   /protein_id="ADY69092.2"
FT                   /translation="MFRDLCRYASQIVVGSTVLAVNVSVLSVAVQLRGAVAVYEVASKC
FT                   VTALEDCVSDLRDSLKPVPDELYNPSLCAALRMNNTDTELTAEDLLTTDRVLVNTWETD
FT                   EAKFKYRYKARIQSGQRGRFMYELVAYGKNHFGRAPRCCDSNYLSVTRLLVNRCNELHL
FT                   TPTQTRNVVAEAVSLVFIPDEEEIRQTMLTNSHYAYMQRTRQSVVSTVEPWWKELLLGP
FT                   SNAKNWRRAWIEICGLPEKQAISFAK"
FT   CDS             2312. .2515
FT                   /codon_start=1
FT                   /product="putative movement protein 1"
FT                   /db_xref="GOA:F1BA31"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:F1BA31"
FT                   /protein_id="ADY69094.1"
FT                   /translation="MSTVDKPIIEVGLPQTNIVEDTATKRGRTKNGRAVALKGIDSHST
FT                   GSAIGGITIVAETVSVVNHFNF"
FT   CDS             2412. .2651
FT                   /codon_start=1
FT                   /product="putative movement protein 2"
FT                   /db_xref="UniProtKB/TrEMBL:F1BA32"
FT                   /protein_id="ADY69095.1"
FT                   /translation="MSHSRGLIHTLLVLLLVVSLLWLKQYRWSITLTFDSSLNRVIALA
FT                   LLGAVLTSVGNSSTVYYINNSTNENKTNHIKIET"
FT   CDS             2648. .3688
FT                   /codon_start=1
FT                   /product="putative coat protein"
FT                   /db_xref="GOA:F1BA33"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:F1BA33"
FT                   /protein_id="ADY69096.1"
FT                   /translation="MNGISQNDPKVVKAAEAGIPWAIKLRSRGWRSLRTNQKLAARAFV
FT                   GSSAPSVAIVPRVTRLVRGNPQRTRRNPQQPGNAADSTTITKSDFVADVIGNTTEAGTV
FT                   TSWLINPSNVVAFPSLLNESARWEKYKITKFSIRFSSKCSEYTDGGVVVQFASDSTDAV
FT                   PTSKYGIMQSQCRADASAHGSVLLNCAVDPKVRFVRDSSADSGKVVDYGRVNLCAYGQK
FT                   AADPSIIGELFFEYTIVFSEARVNRGVTQYQYLLTDSVDGPSFASVTSTSAELTFTFNL
FT                   PGKYTFICSFTGTVSGLYAADLTYNWSVDNTTAVAGVVTVTSPGATLSWAIGATVTSLL
FT                   WQCNIF"
XX
SQ   Sequence 3929 BP; 1040 A; 884 C; 1019 G; 986 T; 0 other;

hm640935 Length: 3929  07-SEP-2011  Type: N  Check: 976  ..

       1  ggtatctgtt tgccgacaat accacgatgt ttcgcgattt gtgccgatac
      51  gctagtcaga tagtggttgg tagcacagtg ctggctgtga atgttagtgt
     101  tttgtccgta gctgtacaac ttcggggtgc agtggcggtc tatgaagtgg
     151  ccagtaaatg tgtgacagcg ctggaagact gcgtttccga tcttcgtgat
     201  tcgctgaagc cagttcccga cgagctgtac aatccttcct tgtgtgcggc
     251  tctgcgtatg aataacactg acacagaact aacagctgaa gaccttttaa
     301  ccacagacag agttttggtc aacacttggg aaaccgatga ggccaaattc
     351  aaatataggt acaaggcgag aatacagagc gggcagcgtg ggaggtttat
     401  gtatgagctt gtagcatatg gcaagaacca cttcgggcgg gcgccgagat
     451  gttgcgatag caactatctt agtgtcactc gattgctggt aaaccgatgc
     501  aatgagctac acttgacccc cactcaaacg cgcaacgttg tagctgaggc
     551  ggtgtcttta gttttcattc ctgatgagga agaaatccgc cagaccatgc
     601  taacaaattc acattatgct tacatgcaac gcacccggca gagcgttgta
     651  tccaccgtcg aaccgtggtg gaaagagctg ttgcttggtc cgtctaacgc
     701  taaaaattgg cgacgagctt ggatcgaaat ctgtggattg cctgaaaaac
     751  aggcgatctc cttcgctaaa taggggtgcc tctggcgcac acggggtgta
     801  actactaaca tatttagggc acaccacccc gatgtcactg agtgccacga
     851  ggctaatgtt cacgttaggg atacttacct gtacggcgca cgattgacga
     901  atggcctgaa gattggggtg catcgcaatg attttcccaa ccttcggcga
     951  ggcgtcatgg agcgcgtgta ctatgtagaa aacagtgaaa caaaacaatt
    1001  gcagagccct ataacacccg tcgatggtat ttatcggagc atgaaataca
    1051  tccgtctaaa actcggagga tacatcggtc ttcattcccg gacacccatg
    1101  cagaaatgtg tggatatgta caagggcagg aagcggcgta cttaccaaag
    1151  agcaatggat gaatgtaaac ttgaaccgtt caatcctcga tgggcgcacg
    1201  ttaagaactt tcttaaacgt gagaaattga acttatctgc aaaacctgac
    1251  ccggcagcaa gaattatcag tcctagagat cctaggtaca acatacactt
    1301  ggcgtgttac cttaaacctt ttgagcatca tctgtaccgc gccatagaca
    1351  atctctgggg ccaacctacg gtaatgaaag gctacacagt tgaagaggtt
    1401  gggcaactat ttcatcgatc gtggagtgca ttccgcaaac ctgttgcagt
    1451  cggattcgat atgaaacggt tcgaccaaca cgtaagcgtt gccgctttgc
    1501  agtttgagca cgctgtatac ttacaggctt ttggttacga tgctcacttg
    1551  caaagaatgc tatcactgca gcttaacaat atgtgcaatg catattgtaa
    1601  gaatggcaaa ctgagatata ataaaatggg aacccgaatg agtggcgatc
    1651  tgaatacgag ttgcggaaac gtgttgttag cttgtgctat cacttacgac
    1701  atttgcaagc gcattgggct gaaagcacat ctacttaaca atggggatga
    1751  ttgtgttcta atactagaaa gcgaagacct gcctcgtgtc gagatccttg
    1801  atacattgtg ggctgaatac ggattcgtgt gtatagtgga gaaaccagtc
    1851  ttcgaaattg aagagataga attttgccag atgcaccctg tatttgcgaa
    1901  tagtgggtac gtgatggtgc gcaatcctca tgtgagcatc gccaaggacc
    1951  aacactcgct aatcccatgg actaatgtca aagttgccaa acagtgcttg
    2001  aaagctatag gtgaatgtgg tagtagtctc acgagcggca tcccgatggt
    2051  ccatgcattt taccaatgct tgctgcgtaa tactagcgac gtgcgtatta
    2101  atccaaatct acgtgaggct agtgcagcgg catattttgg gatgggagga
    2151  cgaacccggg gcacacacag catcagtgaa cggacccgat acagcttcta
    2201  tctggcgttt ggaatcaccc ctgatgaaca acgcgcattt gaagacgatt
    2251  gggaaaggga aactattgtc tgggagtggg cccccgacgg atttgttgcc
    2301  gcaaaccacg catgtctaca gttgataagc caatcataga agtaggtcta
    2351  ccgcaaacta acatagtaga agacacagca accaagcgag gtaggacaaa
    2401  gaacggacga gctgtcgcac tcaaggggat tgattcacac tctactggtt
    2451  ctgctattgg tggtatcact attgtggctg aaacagtatc ggtggtcaat
    2501  cactttaact tttgattctt cactcaaccg tgtaattgct ctagccctct
    2551  tgggcgctgt attaactagc gtaggtaatt ctagcaccgt atattacatt
    2601  aataatagta ccaacgagaa caagacaaac cacatcaaaa ttgagacatg
    2651  aacggcattt cacaaaatga tcctaaagtt gttaaggctg cagaagctgg
    2701  aataccgtgg gctattaaac tgcgttctcg cggttggcgt agtctgcgta
    2751  ctaaccagaa gcttgcagct cgcgcttttg tggggtctag tgctccgagt
    2801  gttgctattg tcccacgagt tactcgactc gttcgaggta acccgcaaag
    2851  gactcgtcgc aatcctcaac aaccaggcaa cgctgctgac agtactacga
    2901  tcacaaaatc agattttgtc gcagacgtta tcggcaatac aacagaggca
    2951  ggaaccgtca cctcatggct gatcaatcca tcaaacgtgg tggcgtttcc
    3001  ttcattactc aatgagagtg cccgctggga aaagtacaag atcacgaagt
    3051  tcagcattag attcagttcg aaatgcagcg aatacaccga tggaggtgtg
    3101  gttgtccagt tcgcgtcgga tagtacagac gccgttccaa cgagcaagta
    3151  cggcattatg cagtcgcagt gtcgagcaga tgcaagcgcc cacggctcag
    3201  tgctccttaa ctgtgctgtt gatccgaagg tgcggtttgt gcgagactct
    3251  agtgcggata gtgggaaagt cgttgactac ggtcgcgtca atctttgtgc
    3301  gtatggtcag aaagcagcgg atccttctat tataggtgag ctgttctttg
    3351  agtacaccat cgtgtttagt gaggcgcggg tgaatcgcgg cgtcactcaa
    3401  tatcagtact tgctgactga cagtgtcgac gggccgtcgt ttgcgagcgt
    3451  cacgagcacg tctgctgagc tgacatttac atttaatctg cctggcaaat
    3501  acacgttcat atgttctttc accggaacag tgagcgggtt gtatgctgca
    3551  gatctaacgt ataactggag cgtagataac accactgcag tggctggtgt
    3601  cgtaacggta acatcgcctg gcgcaacact tagttgggcc attggagcaa
    3651  ctgttacgag cctgttgtgg cagtgtaaca tcttttagag tagactattc
    3701  gggtagagaa cgcgttgaga catggttaaa gggccccggc aagggtaatg
    3751  gcatcgctgg cgcgttcatg ggtatcccca ctggtggtgg gcgtgtataa
    3801  actctctgat ctccaggaca cgctggagaa cgtacctgca taaaatcttg
    3851  gagctggacc aagtgggctt gttaggtact ccctagactt tgtcttaaag
    3901  ggaaccgtgt gactcggttc tccttgccc