Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate Zan coat protein gene, complete cds.

ACC No: HQ117870

Dated: 2011-03-22 | Length: 1047 | CRC: 1937866309

                
ID   HQ117870; SV 1; linear; genomic RNA; STD; VRL; 1047 BP.
XX
AC   HQ117870;
XX
DT   22-MAR-2011 (Rel. 108, Created)
DT   22-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate Zan coat protein gene, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Chen C.-C., Ko W.-F., Lin C.-Y., Jan F.-J., Hsu H.-T.;
RT   "First Report of Carnation mottle virus in Calla lily (Zantedeschia spp.)";
RL   Plant Dis. 87(12):1539-1539(2003).
XX
RN   [2]
RP   1-1047
RA   Lin C.-Y., Chen C.-C., Jan F.-J.;
RT   ;
RL   Submitted (11-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, National Chung Hsing University, 250 Kuo Kuang Road,
RL   Taichung, Taiwan 402, R.O.C.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /organism="Carnation mottle virus"
FT                   /host="calla lily"
FT                   /isolate="Zan"
FT                   /mol_type="genomic RNA"
FT                   /country="Taiwan"
FT                   /db_xref="taxon:11986"
FT   CDS             1. .1047
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADZ55762.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLVGCTPAILTFTPRRPRLTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLAMSFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTNVGFYDLGKHVETAAPTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFAKPTLLGPGISGDVDYESARPIAVCELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 291 A; 253 C; 284 G; 219 T; 0 other;

hq117870 Length: 1047  22-MAR-2011  Type: N  Check: 1043  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgttggatgc
     151  actccagcga tcctaacctt cacaccccga cgaccacggc tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ttaagcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctgg cgatgagctt caacaagtac cgcattactg
     401  cgctcactgt gaagtactca cccgcgtgca gcttcgagac caatgggagg
     451  gtggctctgg gatttaacga tgacgcttcg gacacaccgc caaccaccaa
     501  tgttggattt tacgatctgg gcaaacatgt ggaaactgct gcaccgacag
     551  ccaaggatct tgtgatacca gtcgacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttgtttatac
     701  agtacacgat tgtgctgagc gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaac taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gagggaggct tcgccaaacc cacacttctt
     901  gggccgggca tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  cgtttgtgaa ttggtgacac aaatggaggg ccagatattg aatatcacca
    1001  aaacctcagc agaacaacca ctccaatggg ttgtttatag gatgtga