Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate China, complete genome.

ACC No: HQ660513

Dated: 2011-06-26 | Length: 4003 | CRC: 956149906

                
ID   HQ660513; SV 1; linear; genomic RNA; STD; VRL; 4003 BP.
XX
AC   HQ660513;
XX
DT   26-JUN-2011 (Rel. 109, Created)
DT   26-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate China, complete genome.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4003
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Cai H., Chen H.R.;
RT   ;
RL   Submitted (26-NOV-2010) to the INSDC.
RL   College of Plant Protection, Yunnan Agricultural University, Kunming,
RL   Yunnan 650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4003
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="China"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="25-Oct-2010"
FT                   /db_xref="taxon:11986"
FT   misc_feature    70. .2679
FT                   /note="similar to RNA-dependent RNA polymerase"
FT   CDS             2334. .2519
FT                   /codon_start=1
FT                   /product="P7 protein"
FT                   /protein_id="AEI55439.1"
FT                   /translation="MDIEPEVPVVGKQLLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             2425. .2679
FT                   /codon_start=1
FT                   /product="P9 protein"
FT                   /protein_id="AEI55438.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLKCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             2669. .3715
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEI55437.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCFIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 4003 BP; 1121 A; 859 C; 1095 G; 928 T; 0 other;

hq660513 Length: 4003  26-JUN-2011  Type: N  Check: 4349  ..

       1  gggtaagctg gcgggcaaac ctacactcta tcttaattgc attatatatt
      51  ccaaccatct gctttcacta tgggattacc cagtctacta gtggaaggcg
     101  ttattggatg cactctagtc ggtggtttgg tagctgtggg tagcgcagcg
     151  ctggccgttc gggcaaccat cggtgttgta gaattcaata gggagtgtgt
     201  gcgcggggcg agaaggatcg tagctagcgg aggaaagtgc ttaatagtcc
     251  aatcccctta tggcaatccc aaccaaggat agataagagg tgaagacgaa
     301  gaaattgata atgtggagga gtcaacaccg gaggaattga ctcagttgat
     351  tgaggttaag gcggaagtgg atgggaaaga ggtcgttgtc tctaagaagc
     401  gtgtagtaaa caggcacttg agacaacgat tcgttcgctc catagccatc
     451  gaagccaaga atcactttgg tggtgacatc agccctagca aggccaacta
     501  tctttccgtt tccaagtttt tgacggggaa atgcaaggag agacatgttg
     551  tgcccgctca cactagagat tgtgtgagtg ctgctatggt gctggtgttt
     601  acccctgacg tccacgagat caggatgatg gcaggattgg cgtctgacgc
     651  agcgtacgga agaaagatcg caatggcaag catactgaac aggaaggggt
     701  ggtgctggag gctgatggta aatccattag atagggcaag atggtgggaa
     751  atgtggtgcg ttgtaaacgg gtttgactcc aacaaacccg tcacctttcc
     801  caaatagggg ggcctgttct acctcaatgg tgtggagacg aaaattcgtc
     851  gtggaggcca cccatcagtg attgaggtag acgggcaatg tcctcccaaa
     901  gagagaaaac tctacgtaca gaatgccata accactggtt atgaatatag
     951  ggtccacaac cattcgtacg caaacctcag acgagggctc cttgaaagag
    1001  ttttctatgt tgagcgcaac aaggagctag tcagctgtcc gcaacctgaa
    1051  cccggcagct ttaaagagat gggatacctg cgacgcaggt tccatagagt
    1101  gtgtggtaat cattcccgga tctctgccaa tgatttggta gattgttatc
    1151  agggcaggaa acgcacaatc tatgagaatg cagcagcgtc tctactcgat
    1201  agagctatcg aaaggaagga tggcgatctc aaaaccttta tcaaggcgga
    1251  gaaattcaac gtgaatctga aaagtgatcc tgctcctcgg gttatacaac
    1301  ctaggagccc tcgctacaat gtggagttgg gccggtactt aaagaagtat
    1351  gaacaccatg cttacaaagc cttagacaag atctggggag gaccaacagt
    1401  catgaaagga tacactacag aggaggtagc acagcacatt tggagcgcat
    1451  ggaatcaatt ccagacacct gtagccatag gatttgacat gtcacgattc
    1501  gatcagcatg tgtctgtagc cgcgctcgag ttcgaacatt catgctattt
    1551  ggcctgtttt gaaggggacg ctcatctcgc caatttgctt aaggtgcaac
    1601  tggtgaatca tggcgtgggt tttgctagca atggaatgtt gcgatacact
    1651  aaggaagggt gcggaatgag cggtgacatg aacactgcct tgggcaactg
    1701  tttgttggct tgccttatca ccaaacactt aatgaaaatc aggagcagac
    1751  tgatcaacaa tggggatgac tgcgtgctta tttgcgaaag aacagacacc
    1801  gactacgtcg tgagtaattt aacgacggga tggagtcgat ttggattcaa
    1851  ttgcatagca gaagagccag tgtacgaaat ggaaaagatc aggttctgcc
    1901  agatggcacc ggtgtttgat ggagcaggtt ggctgatggt cagggaccct
    1951  ttggtgagca tgagcaagga ttctcactcc ttagtgcatt ggaacaacga
    2001  aaagaatgca aaacaatggc tgaaatcagt gggaatgtgc ggtctgcgga
    2051  ttgccggggg ggttccagtt gtgcaagagt tctaccaaaa atacgttgaa
    2101  acagccggga atgtgagaga gaacaaaaat atcacggaga agagtagttc
    2151  tgggttcttt atgatggcgg atcgcgctaa gcggggctat tctgctgtgt
    2201  ctgaggtgtg ccgattcagc ttctaccagg cattcggcat tacgccagac
    2251  cagcaaatcg cgttggaggg ggagatcagg tctctcacta tcaacaccaa
    2301  cgtggggccc cagtgtgaag cggcagattc actatggata ttgaaccgga
    2351  agtaccagta gttgggaagc aattgctcgc tgggaataga ggaaaacaaa
    2401  agacacgtag atcggtggcc aaggatgcca tccgtaaacc tgcatctgat
    2451  agtactaacg ggggtaattg ggttaatgtt gctgataaga ttgaagtgca
    2501  cattcacttc aacttttagt ttgcccccac tggtaacttt aaatcagata
    2551  atagcgttgt cattttgtgg tcttctatta aacagcatct ctcgggcaga
    2601  aagagcttgc tattacaact actctgttga tagttctaaa caacaacaca
    2651  tttcgataag tacaccaaat ggaaaataaa ggagaaaaga tcgcgatgaa
    2701  tcccactgtg caaacattgg cgcagaaggg ggacaagtta gccgtgaagt
    2751  tggtgacaag gggttgggcc tctctgagta cgaaccagaa gaggagagct
    2801  gaaatgcttg ctggatacac tccagcgatc ctagccttca caccccgacg
    2851  accacggatg acgaaccctc ctccaagaac cagtaggaat tcaccaggac
    2901  aagctggaaa gtccatgacg atgagtaaga ccgaactatt aagcaccgtc
    2951  aaaggtacca caggtgttat cccaagcttt gaagactggg tcgtttcccc
    3001  ccgaaacgta gccgtcttcc ctcaactctc gctgctggcg acgaacttca
    3051  acaagtaccg cattactgcg ctcactgtga agtactcacc cgcgtgcagc
    3101  ttcgagacca atgggagggt ggctctggga ttcaacgatg acgcttcgga
    3151  cacaccacca accaccaagg ttggatttta cgatctgggc aaacatgtgg
    3201  aaactgctgc acagacagct aaggatctag tgataccagt agacggcaaa
    3251  acccggttca tcagggactc ggctagtgat gatgccaaac tagtcgattt
    3301  tgggcggata gtcttgtcaa catacgggtt tgacaaggct gacactgtgg
    3351  tgggcgaatt attcatacag tacacgattg tgctgagtga cccaaccaag
    3401  acggccaaaa tttcacaggc aagcaacgat aaggtgtcgg acggaccaac
    3451  gtatgtggtc ccttcggtca atggcaacga gctacaacta agagtggtag
    3501  ccgctgggaa atggtgcttt atagtgcggg gtacggttga gggaggcttc
    3551  accaaaccca cacttattgg gccaggaatc agcggtgacg tggactatga
    3601  aagtgccaga cctatcgcca tttgtgagtt ggtgacacaa atggagggcc
    3651  agatattgaa aatcaccaag acctcagcag aacagccact ccaatgggtt
    3701  gtttatagga tgtgaatgcg atagaaaagt ttgttagaca cacacggcgg
    3751  gacgtgttgc cggagctgcc actccgtcca agatgggtcg atattaacca
    3801  tctttggcaa cagcgtgcgt gactaatcga acctagtaat tgcatagcat
    3851  ccgactgtaa cctgttttct gctgaagacg agggtggtct cgtgatccca
    3901  aaccataaaa gaaaccaact tgttggtgga agggcttgga agtaggatca
    3951  accactgttt attaattagg ggtgagagta ttcactgtac tctttccccg
    4001  ccc