Sequence of DPV Honeysuckle ringspot virus

Honeysuckle ringspot virus isolate California, complete genome.

ACC No: HQ677625

Dated: 2011-09-14 | Length: 3956 | CRC: -551739693

                
ID   HQ677625; SV 1; linear; genomic RNA; STD; VRL; 3956 BP.
XX
AC   HQ677625;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   14-SEP-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Honeysuckle ringspot virus isolate California, complete genome.
XX
KW   .
XX
OS   Honeysuckle ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3956
RX   PUBMED; 21562880.
RA   Gulati-Sakhuja A., Rains L., Tian T., Liu H.Y.;
RT   "The complete nucleotide sequence and genome organization of a novel
RT   carmovirus - honeysuckle ringspot virus isolated from honeysuckle";
RL   Arch. Virol. 156(9):1635-1640(2011).
XX
RN   [2]
RP   1-3956
RA   Gulati-Sakhuja A., Sears J., Rains L., Tian T., Liu H.-Y.;
RT   ;
RL   Submitted (03-DEC-2010) to the INSDC.
RL   Virology, USDA-ARS, 1636 E Alisal Street, Salinas, CA 93905, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3956
FT                   /organism="Honeysuckle ringspot virus"
FT                   /host="honeysuckle"
FT                   /isolate="California"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:943272"
FT   gene            34. .2676
FT                   /gene="P101"
FT   CDS             34. .2676
FT                   /codon_start=1
FT                   /transl_except=(pos:766. .768,aa:OTHER)
FT                   /transl_except=(pos:2326. .2328,aa:OTHER)
FT                   /gene="P101"
FT                   /product="p101"
FT                   /note="double read-through protein"
FT                   /db_xref="GOA:E7EEK3"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:E7EEK3"
FT                   /protein_id="ADV15469.1"
FT                   /translation="MLLDFCFKAIIAPPIVGTVVAMGLAGLTVRTTIGVVEFEARAVRT
FT                   VVDYITSKGKTLPGKPKYPKAKVNVFLEELAEVDGDDRELPDLLETVEVKKEDGEGKMV
FT                   VVRTKAKVNRHTRGRFVHRLVCATKNHLGGTPNNSTANKLVAYKFMVGKCKEQHLVETH
FT                   TREVCSLAMAAIFTPDVHDVNMHLALNSHAAYRRRVALAQAQEVQSWQLRLLKHPLKYD
FT                   SWERAWLWANGAPTQEPFRFIKXGGLCYFEGVDTKIRRGSHPLMIEVEKDGPHKLRKLY
FT                   AQNVMSSGLDYRVHNHSFQNLRRGLLERVFYVESKDKKELVDCPQPNQAAFKELAYLRK
FT                   QFARYAGIHTRISTQDMVDCYHGRKKSIYQNAADSLSDRPLDRKDAALKTFIKAEKFCI
FT                   NLKPDPAPRVIQPRSVRYNVELGRYLKKYEHSAYRALDKIWGGTTVMKGYTVEQVGEHI
FT                   ASAWGEFQIPVAVGFDMSRFDQHVSVPALQFEHSCYMKSFKHDRELQQLLSWQLTNFGV
FT                   AFADDGMIRYKKAGCRMSGDMNTALGNCLLACMITKHLMRDLKCRLVNNGDDCVLFCES
FT                   RDLGSVVSNLTTGWREFGFNCIAEEPVYILEEVRFCQMAPVFDGESYVMVRDPRVSISK
FT                   DAFSLVHWNNSKNALQWMKSVGLCGERITGGIPVVQEFYRKYQQIAGDVRLPKLNVDIE
FT                   SSGVYMLANKMKRAFKEPTDEARFSFYLAFGIIPDLQIAVEKSIRDIPEDVEFGPCDKL
FT                   ADYTLKWTFNQXKQKMTLAFKVTWREVATGERRREEYQSQKMLSTNGHLMVLSGVLIIF
FT                   LLIKWKIPLTLISVEVDYKPPVILLFIIFITLQLIYQYTTALLAEKVVYNTTEANNTRV
FT                   QYISIKQKQ"
FT   gene            34. .2328
FT                   /gene="P87"
FT   CDS             34. .2328
FT                   /codon_start=1
FT                   /transl_except=(pos:766. .768,aa:OTHER)
FT                   /gene="P87"
FT                   /product="p87"
FT                   /note="RNA-dependent RNA polymerase; readthrough protein"
FT                   /db_xref="GOA:E7EEK4"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:E7EEK4"
FT                   /protein_id="ADV15468.1"
FT                   /translation="MLLDFCFKAIIAPPIVGTVVAMGLAGLTVRTTIGVVEFEARAVRT
FT                   VVDYITSKGKTLPGKPKYPKAKVNVFLEELAEVDGDDRELPDLLETVEVKKEDGEGKMV
FT                   VVRTKAKVNRHTRGRFVHRLVCATKNHLGGTPNNSTANKLVAYKFMVGKCKEQHLVETH
FT                   TREVCSLAMAAIFTPDVHDVNMHLALNSHAAYRRRVALAQAQEVQSWQLRLLKHPLKYD
FT                   SWERAWLWANGAPTQEPFRFIKXGGLCYFEGVDTKIRRGSHPLMIEVEKDGPHKLRKLY
FT                   AQNVMSSGLDYRVHNHSFQNLRRGLLERVFYVESKDKKELVDCPQPNQAAFKELAYLRK
FT                   QFARYAGIHTRISTQDMVDCYHGRKKSIYQNAADSLSDRPLDRKDAALKTFIKAEKFCI
FT                   NLKPDPAPRVIQPRSVRYNVELGRYLKKYEHSAYRALDKIWGGTTVMKGYTVEQVGEHI
FT                   ASAWGEFQIPVAVGFDMSRFDQHVSVPALQFEHSCYMKSFKHDRELQQLLSWQLTNFGV
FT                   AFADDGMIRYKKAGCRMSGDMNTALGNCLLACMITKHLMRDLKCRLVNNGDDCVLFCES
FT                   RDLGSVVSNLTTGWREFGFNCIAEEPVYILEEVRFCQMAPVFDGESYVMVRDPRVSISK
FT                   DAFSLVHWNNSKNALQWMKSVGLCGERITGGIPVVQEFYRKYQQIAGDVRLPKLNVDIE
FT                   SSGVYMLANKMKRAFKEPTDEARFSFYLAFGIIPDLQIAVEKSIRDIPEDVEFGPCDKL
FT                   ADYTLKWTFNQ"
FT   gene            34. .768
FT                   /gene="P27"
FT   CDS             34. .768
FT                   /codon_start=1
FT                   /gene="P27"
FT                   /product="p27"
FT                   /note="replication-related protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7EEK5"
FT                   /protein_id="ADV15467.1"
FT                   /translation="MLLDFCFKAIIAPPIVGTVVAMGLAGLTVRTTIGVVEFEARAVRT
FT                   VVDYITSKGKTLPGKPKYPKAKVNVFLEELAEVDGDDRELPDLLETVEVKKEDGEGKMV
FT                   VVRTKAKVNRHTRGRFVHRLVCATKNHLGGTPNNSTANKLVAYKFMVGKCKEQHLVETH
FT                   TREVCSLAMAAIFTPDVHDVNMHLALNSHAAYRRRVALAQAQEVQSWQLRLLKHPLKYD
FT                   SWERAWLWANGAPTQEPFRFIK"
FT   gene            2310. .2513
FT                   /gene="P7"
FT   CDS             2310. .2513
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="p7"
FT                   /db_xref="GOA:E7EEK6"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:E7EEK6"
FT                   /protein_id="ADV15470.1"
FT                   /translation="MDVQPVEAKDDTRIQSDVERGGNRGKTKGRISIAKDAINKRASDG
FT                   SIGGTYYIFADKVENTVNFNFG"
FT   gene            2338. .2676
FT                   /gene="P13"
FT   CDS             2338. .2676
FT                   /codon_start=1
FT                   /gene="P13"
FT                   /product="p13"
FT                   /db_xref="UniProtKB/TrEMBL:E7EEK7"
FT                   /protein_id="ADV15471.1"
FT                   /translation="MTLAFKVTWREVATGERRREEYQSQKMLSTNGHLMVLSGVLIIFL
FT                   LIKWKIPLTLISVEVDYKPPVILLFIIFITLQLIYQYTTALLAEKVVYNTTEANNTRVQ
FT                   YISIKQKQ"
FT   gene            2676. .3710
FT                   /gene="P37"
FT   CDS             2676. .3710
FT                   /codon_start=1
FT                   /gene="P37"
FT                   /product="p37"
FT                   /note="coat protein"
FT                   /db_xref="GOA:E7EEK8"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR013669"
FT                   /db_xref="UniProtKB/TrEMBL:E7EEK8"
FT                   /protein_id="ADV15472.1"
FT                   /translation="MDTLRNSKKVAQLSASGVLWATKYMTRGWQSLSTNQKRLARAALN
FT                   LPLTPQVISPVRPRVRNPQPRGAANGLGQAGKTQTITRSEYVADVVKTVGATPTFTTWV
FT                   INPRSVRSFPGTSVCSLGYEKYRVVNFRVRYSNSLSDDVSGKVSIGFTPDSSDPIPTNK
FT                   TQLYQMRVSMDTAAKESKTLTIPTDNATRYLRDSSIDDAKVVDFGRVVLATYGFDQSAP
FT                   EVIGEIHFEYTLVLSDPNFVTTLTQKGTNSEYEGPLYGALERTNSAITLTLQAPGNWLV
FT                   VWISPEAFNSPTVTGSGASGTVSYQSGGSSMAVTTVIANLPGAQVTAPTTTAVKELQWY
FT                   VSRL"
XX
SQ   Sequence 3956 BP; 1102 A; 855 C; 1071 G; 928 T; 0 other;

hq677625 Length: 3956  14-SEP-2011  Type: N  Check: 3998  ..

       1  ggggttttcc ggttggggcc cagttcactg acgatgcttc ttgacttctg
      51  tttcaaagcc atcattgctc cccccattgt ggggaccgtg gttgctatgg
     101  gtctggcagg actcacagtg agaacaacaa tcggtgtggt tgaattcgag
     151  gcacgggcag ttaggaccgt cgtcgattac atcaccagca aagggaaaac
     201  attaccaggg aagccgaaat acccgaaggc taaggttaat gtcttcctcg
     251  aagagctggc agaggtggac ggtgatgatc gtgagctgcc cgatctcctc
     301  gaaacggtcg aggttaagaa ggaggatggc gaagggaaaa tggtcgttgt
     351  gcgaacaaag gccaaggtta accgccatac cagaggtagg tttgtgcata
     401  ggctagtttg cgcaaccaag aaccatctgg gggggacgcc gaataacagt
     451  acggccaaca agctggtggc gtacaaattc atggtgggga aatgcaagga
     501  gcaacacctt gtagagaccc acaccaggga ggtgtgctcg ctggctatgg
     551  ccgccatatt tacccccgac gtgcatgatg tcaacatgca cctcgcactt
     601  aacagtcacg ccgcctacag acggcgcgta gccttggctc aagcgcaaga
     651  ggtgcagagc tggcaactaa ggctactaaa acaccctctc aaatatgata
     701  gttgggagag ggcgtggtta tgggccaatg gcgctccaac ccaggagccc
     751  tttaggttca taaaataggg gggtctttgc tacttcgagg gtgtggatac
     801  aaaaattcgt aggggatcac accctctgat gatcgaagta gaaaaagatg
     851  gtccccacaa acttaggaaa ctctacgcgc aaaatgtgat gagcagcgga
     901  cttgactacc gtgttcacaa tcattcattc caaaaccttc gaagaggtct
     951  cctcgaaaga gttttctacg tggaaagtaa agataagaag gagttagtcg
    1001  attgccccca acccaaccag gctgctttca aggagttggc ttacttgagg
    1051  aagcaatttg ctagatacgc tggaattcat accaggatct ccacccaaga
    1101  tatggtggat tgttatcatg gcaggaagaa aagcatctat caaaacgcag
    1151  ctgatagttt gtctgaccgg cccctggacc ggaaggatgc tgcactcaaa
    1201  acattcatta aagctgaaaa attctgtatt aatctgaaac ccgacccagc
    1251  tcccagagtt atacaacctc gaagcgtgcg ttacaatgtg gaattaggta
    1301  gatacctaaa gaaatatgaa cattccgctt accgagcgct agataaaatc
    1351  tgggggggga ctacagtgat gaagggatac acggtagaac aggtgggaga
    1401  gcatatagcc tctgcgtggg gagaattcca gattcccgtt gcagttggat
    1451  ttgacatgag cagattcgac caacatgttt ctgtgcctgc gctccagttc
    1501  gaacactcct gttacatgaa atccttcaaa catgatcgag aacttcaaca
    1551  gttgttatcc tggcaattaa caaactttgg agttgcgttc gctgatgatg
    1601  gtatgatccg ttacaagaag gccgggtgtc gtatgagtgg tgacatgaat
    1651  acggcactag gcaattgtct ccttgcctgt atgattacga agcacctgat
    1701  gagagacctc aagtgccggc ttgtgaacaa tggggatgac tgcgtgttgt
    1751  tttgcgaatc tagggatctc ggctcagtcg tgagcaattt aacgactggt
    1801  tggcgggaat ttggattcaa ttgcatcgca gaggaacctg tttacattct
    1851  ggaggaagtg aggttttgtc agatggcgcc cgtatttgat ggggagtcat
    1901  atgtgatggt gagagaccct cgggtaagca tcagcaagga cgctttttcc
    1951  ttggtccatt ggaacaacag taaaaatgcc ctccaatgga tgaagtcggt
    2001  cggtttgtgt ggagagcgta taacaggggg gattccagtc gttcaggagt
    2051  tctaccggaa gtatcaacaa attgctggag acgtgcgctt gccgaagttg
    2101  aacgtagata tcgagtctag cggcgtgtat atgttggcta acaaaatgaa
    2151  aagggccttt aaagaaccta ccgatgaggc taggtttagt ttctacttgg
    2201  cctttggtat catcccggat ttgcaaattg cagtggagaa atccattagg
    2251  gatataccag aggatgtaga gtttgggccc tgtgataagt tggcagacta
    2301  tacactcaaa tggacgttca accagtagaa gcaaaagatg acactcgcat
    2351  tcaaagtgac gtggagagag gtggcaacag gggaaagacg aagggaagaa
    2401  tatcaatcgc aaaagatgct atcaacaaac gggcatctga tggttctatc
    2451  gggggtactt attatatttt tgctgataaa gtggaaaata ccgttaactt
    2501  taatttcggt tgaagttgac tataagcccc cggtgatttt gttattcatt
    2551  atcttcataa ctcttcagtt gatttaccag tacaccacag cactcttggc
    2601  agagaaagtt gtctacaata cgacggaagc aaacaacacc agggttcagt
    2651  acattagcat taaacagaag caataatgga tactttgagg aacagcaaga
    2701  aggtcgcgca actctccgcg agtggagttc tctgggctac aaaatacatg
    2751  accagaggat ggcaaagttt gagtaccaac cagaaaaggt tggctagagc
    2801  tgcgctcaac ttacccttga ccccacaggt gatctcaccg gtgaggccga
    2851  gggtaagaaa cccacagccg agaggtgctg cgaacggatt agggcaagca
    2901  ggtaagactc agacaatcac gagatcagaa tacgtggcgg atgttgtcaa
    2951  aactgtgggt gcaactccca cattcactac ttgggttatt aatcctcgta
    3001  gtgttcgtag ctttcctggc accagtgtgt gcagccttgg atacgagaag
    3051  tatagagtgg tgaactttcg agttcgctac agtaattcct tgtctgatga
    3101  cgttagtggg aaggtgtcaa ttgggttcac tccggactca agtgacccta
    3151  ttcccactaa taagacgcaa ctctatcaga tgagagtatc catggacact
    3201  gctgccaagg agagcaagac gttgacaata ccgacagaca acgccacgcg
    3251  ttatctcaga gattcatcca tcgatgatgc caaggtggtg gatttcggaa
    3301  gggtcgtgtt agccacatat gggttcgatc agtcagctcc agaggtgatc
    3351  ggagaaatac acttcgagta cactctggtg ctttcggacc ccaacttcgt
    3401  gacgacgcta acacagaaag gcacaaatag tgaatatgaa ggcccgttat
    3451  acggcgcatt agagcgaact aattcagcaa tcacgctaac cctgcaagca
    3501  ccagggaatt ggctggttgt ttggattagc ccagaggcct tcaattcacc
    3551  gaccgtaaca ggatccgggg caagcggaac tgtgagctat caatcaggag
    3601  gcagtagtat ggctgtaact actgtcatcg ccaacttgcc aggtgcgcag
    3651  gtgactgcac caaccacgac tgccgttaaa gagcttcaat ggtatgtctc
    3701  aagactatag acgggatgag cttctggggg ctgccaccct cgcctcatgc
    3751  gcattgcctg ctctgggcgc atgtggaagc tgatatagtt gagagcttcg
    3801  tggaaggatg tggaaaccaa gggagggaga tatccaggga ggatgtcgga
    3851  gttgtaagga taaaatacct aagcttcatc aggttaggtt gggcttccga
    3901  tgcaacaaaa caccagtaga taaatagggg gggatccagg ggatccttct
    3951  ccgccc