Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate YH2 movement protein (P7), movement protein (P9), and coat protein (CP) genes, complete cds.

ACC No: HQ704790

Dated: 2011-07-27 | Length: 1790 | CRC: 1946074086

                
ID   HQ704790; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704790;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate YH2 movement protein (P7), movement protein
DE   (P9), and coat protein (CP) genes, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="YH2"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77585.1"
FT                   /translation="MDIEPEVPVVGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNL"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77586.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   CDS             684. .1730
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AEK77587.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILTFTPRRPRMTNPPPRTSRNSPGQAGKSMAMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLAMNFNKYRITALTVKYTPACSFETNGRVALGFNDDASDTP
FT                   PTSKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTAAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1790 BP; 520 A; 405 C; 475 G; 390 T; 0 other;

hq704790 Length: 1790  27-JUL-2011  Type: N  Check: 2572  ..

       1  acactggaac aacgaaacaa acgcaagaca atggctgaag tcagtaggaa
      51  tgtgcggtct gcggattgcc gggggggttc cagttgtgca agagttctac
     101  cagaaatacg ttgaaacagc cggaaatgtg aaagagaaca aaaatatcac
     151  agagaagagt agttctgggt tctttatgat ggcggatcgc gctaagcggg
     201  gctattccgc tgtgtctgag gtgtgtcgat ttagcttcta ccaggcattc
     251  ggcatcacgc cagaccagca gatcgcgttg gagggggaga tcaggtctct
     301  cactatcaac accaacgtgg ggccccagtg tgaagcggca gattcactat
     351  ggatattgaa ccggaagtac cagtagttgg aaagcaaatg ctcgctggga
     401  atagaggaaa acaaaagaca cgtagatcgg tggccaagga tgccatccgt
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaacct ttagtttgcc cccactggta
     551  actttaaatc agataatagc gttgtctttt tgtggtcttc tattaaacag
     601  catctctcgg gcagaaagag cttgctatta caactactct gttgatagtt
     651  ctaaacaaca acacatttcg ataagtacac caaatggaaa ataaaggaga
     701  aaagatcgcg atgaatccca ctgtgcaaac attggcgcag aagggggaca
     751  agttagccgt gaagttggtg acaagagggt gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctgga tacactccag cgatcctaac
     851  cttcacaccc cgacgaccac ggatgacgaa ccctcctcca agaaccagta
     901  ggaattcacc aggacaagct ggaaagtcca tggcgatgag taagaccgaa
     951  ctactaagca ccgtcaaagg taccacgggt gttatcccaa gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt cttccctcaa ctctcgctgc
    1051  tggcgatgaa cttcaacaag taccgcatca ctgcgctcac tgtgaagtat
    1101  acacccgcgt gcagcttcga gactaatggg agggtggctc tgggattcaa
    1151  cgatgacgct tcggatacac caccaacctc caaggttgga ttttacgatc
    1201  tgggcaaaca tgtggaaact gctgcacaga cagccaagga tctagtgata
    1251  ccagtagacg gcaaaacccg gttcatcagg gactcggcta gtgatgatgc
    1301  caaactagtc gattttggac gaatagtctt gtcaacatac gggtttgaca
    1351  aggctgacac tgtggtgggc gaactattca tacagtacac gatcgtgctg
    1401  agtgacccaa ccaagacggc caaaatttca caggcaagca acgataaggt
    1451  gtcggacgga ccaacgtatg tggtcccttc ggtcaatggc aacgagctac
    1501  aactaagagt ggtagccgct gggaaatggt gcattatagt gcggggtacg
    1551  gttgagggag gcttcaccaa acccacactt attgggccgg gaatcagcgg
    1601  tgatgtggac tatgaaagtg ccagacctat cgccatttgt gaattggtga
    1651  cacaaatgga gggccagata ttgaaaatca ccaagaccgc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga atgcaataga aaagtttgtt
    1751  agacacacac ggcgggacgt gttgctagag ctgccactct