Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate DLS movement protein (P7), movement protein (P9), and coat protein (CP) genes, complete cds.

ACC No: HQ704791

Dated: 2011-07-27 | Length: 1790 | CRC: -537182045

                
ID   HQ704791; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704791;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate DLS movement protein (P7), movement protein
DE   (P9), and coat protein (CP) genes, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="DLS"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77588.1"
FT                   /translation="MDIEPEVPVVAKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77589.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   CDS             684. .1730
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AEK77590.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1790 BP; 514 A; 408 C; 476 G; 392 T; 0 other;

hq704791 Length: 1790  27-JUL-2011  Type: N  Check: 2932  ..

       1  acactggaac aacgaaacaa acgcaaaaca atggttgaag tcagtaggaa
      51  tgtgcggtct gcggattgcc gggggggttc cagttgtgca agagttctac
     101  cagaaatacg ttgaaacagc cggaaatgtg aaagagaaca aaaatatcac
     151  agagaagagt agttctgggt tcttcatgat ggcggatcgc gctaagcggg
     201  gctattctgc tgtgtctgag gtgtgccgat ttagcttcta ccaggcattc
     251  ggcatcacac cggaccaaca gatcgcgttg gagggagaga tcaggtctct
     301  cactatcaac accaacgtgg ggccccagtg tgaagcggca gattcactat
     351  ggatattgaa ccggaagtac cagtagttgc aaagcaaatg ctcgctggga
     401  atagaggaaa acaaaagacg cgtagatcgg tggccaagga tgccatccgt
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaactt ttagtttgcc cccactggta
     551  actttaaatc agataatagc gttgtcattt tgtggtcttc tattaaacag
     601  catctctcgg gcagaaagag cttgctatta caactactct gttgatagtt
     651  ccaaacaaca gcacatttca ataagtacac caaatggaaa ataaaggaga
     701  aaagatcgcg atgaatccca ctgtgcaaac attggcgcag aagggggaca
     751  agttggccgt gaagttggtg acaagagggt gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctgga tacactccag cgatcctagc
     851  cttcacaccc cgacgaccac ggatgacgaa ccctcctcca agaaccagta
     901  ggaattcacc aggacaagct ggaaagtcca tgacgatgag taagaccgaa
     951  ctattaagca ccgtcaaggg taccacgggt gttatcccaa gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt cttccctcaa ctctcgctgc
    1051  tggcgacgaa cttcaacaag taccgcatta ctgcgctcac tgtgaagtac
    1101  tcacccgcgt gcagcttcga gaccaatggg agggtggctc tgggattcaa
    1151  cgatgacgct tcggacacac cgccaaccac caaggttggt ttttacgatc
    1201  tgggcaaaca tgtggagact gctgcacaga cagccaaaga tctagtgata
    1251  ccagtcgatg gcaaaacccg gttcatcagg gactcggcta gtgatgatgc
    1301  caaactagtc gattttggac gaatagtctt gtcaacatac gggttcgaca
    1351  aggctgacac tgtggtgggc gaattgttta tacagtacac gattgtgctg
    1401  agtgacccaa ccaagacggc caaaatttca caggcaagca acgataaggt
    1451  gtcggacgga ccaacgtatg tggtcccttc ggttaatggc aacgagctac
    1501  aactaagagt ggtagccgct gggaaatggt gcatcatagt gcggggtacg
    1551  gttgagggag gcttcaccaa acccacactt attgggccag gcatcagcgg
    1601  tgatgtggac tatgaaagtg ccagacctat cgccgtttgt gaattggtga
    1651  cacaaatgga gggccagata ttgaatatca ccaagacctc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga gtgcaacaga aaagtttgtt
    1751  agacacacac ggcgggacgt gttgctagag ctgccactct