Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate ZY movement protein (P7), movement protein (P9), and coat protein (CP) genes, complete cds.

ACC No: HQ704792

Dated: 2011-07-27 | Length: 1790 | CRC: 453693637

                
ID   HQ704792; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704792;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate ZY movement protein (P7), movement protein
DE   (P9), and coat protein (CP) genes, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="ZY"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77591.1"
FT                   /translation="MDIEPEVPVVGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77592.1"
FT                   /translation="MPSANLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   CDS             684. .1730
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AEK77593.1"
FT                   /translation="MENKGEKIAMNPTVQALAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAVLAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLASNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLVGPGISGYVDYESARPVAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1790 BP; 520 A; 404 C; 469 G; 397 T; 0 other;

hq704792 Length: 1790  27-JUL-2011  Type: N  Check: 3532  ..

       1  acactggaac aacgaaacaa acgcaaaaca atggctaaag tctgtaggaa
      51  tgtgcggtct gcggattgcc gggggggttc cagttgtgca agagttctac
     101  caaaaatacg ttgaaacagc cgggaatgtg aaagagaaca aaaatatcac
     151  agagaaaagt agttctgggt tctttatgat ggcggatcgc gctaagcggg
     201  gctattctac tgtgtctgag atgtgccgat ttagctttta ccaggctttc
     251  ggtatcacac ctgaccaaca gattgcgttg gagggggaga ttagatctct
     301  caccataaac accaacgtgg ggccccagtg tgaagcggca gattcactat
     351  ggatattgaa ccggaagtac cagtagtcgg aaagcaaatg cttgctggga
     401  acaggggaaa acaaaagaca cgtagatcgg tggccaagga tgccatccgc
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaactt ttagtttgcc cccactggta
     551  actttaaatc agataattgc gttgtctttt tgtggtctcc tattaaacag
     601  catctctcgg gcagaaagag cttgctatta caactactct gttgatagtt
     651  ctaaacaaca acacatttcg ataagtacac caaatggaaa ataaaggaga
     701  gaagatcgcg atgaatccca ctgtgcaagc attggcgcag aagggggaca
     751  agttagccgt gaagttggtg acaagaggat gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctgga tacactccag cggtcctagc
     851  cttcacaccc cgacgaccac ggatgacaaa ccctcctcca agaaccagta
     901  ggaattcacc aggacaagct ggaaagtcca tgacgatgag taagaccgaa
     951  ctgttatgca ccgtcaaagg taccacaggt gttatcccta gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt tttccctcaa ctctcgctgc
    1051  tggcgtctaa cttcaacaag taccgcatca ctgcgctcac tgtgaagtac
    1101  tcgccagcgt gtagcttcga gaccaatggg agggtggctc tgggattcaa
    1151  cgatgacgct tcggatacac caccaaccac caaggttgga ttctacgacc
    1201  tgggcaaaca tgtggagact gctgcacaaa cagccaagga tctagtgata
    1251  ccagtagacg gcaaaacccg gttcatcagg gactcggcta gtgacgatgc
    1301  caagctagtc gattttggac gaatagtctt gtcaacatac gggtttgaca
    1351  aggctgacac agtggtgggc gaattgttca tacagtacac gattgtgctg
    1401  agcgacccaa ccaagacggc caaaatttca caggcaagca acgataaggt
    1451  gtcggatgga ccaacgtatg tggtcccttc ggtcaatggc aacgagctgc
    1501  aactaagagt ggtggccgct gggaaatggt gcatcatagt gcggggtacg
    1551  gtagaaggag gcttcaccaa acccacactt gttggaccag gaatcagcgg
    1601  ttatgtggac tatgaaagtg ccagacctgt cgccatttgt gagttggtaa
    1651  cacaaatgga gggccaaata ttgaaaatta ccaagacctc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga atgcaacaga aaagtttgtt
    1751  agacacacac ggcgggacgt gttgctagag ctgccactct