Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate TPY movement protein (P7) and movement protein (P9) genes, complete cds; and coat protein-like (CP) gene, complete sequence.

ACC No: HQ704796

Dated: 2011-07-27 | Length: 1790 | CRC: 82427985

                
ID   HQ704796; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704796;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate TPY movement protein (P7) and movement
DE   protein (P9) genes, complete cds; and coat protein-like (CP) gene, complete
DE   sequence.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="TPY"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77602.1"
FT                   /translation="MDIEPEIPVVEKQVLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77603.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   misc_feature    684. .1730
FT                   /gene="CP"
FT                   /note="similar to coat protein"
XX
SQ   Sequence 1790 BP; 527 A; 407 C; 465 G; 391 T; 0 other;

hq704796 Length: 1790  27-JUL-2011  Type: N  Check: 2213  ..

       1  acactggaac aacgaaacaa acgcaagaca gtggctaaag tcagtgggaa
      51  tgtgcggtct gcggattgcc gggggggttc cagttgtgca agagttctac
     101  caaaaatacg ttgaaacagc cggaaatgtg aaagggaaca agaatatcac
     151  agagaagagc agttctgggt tcttcatgat ggcggatcgc gctaagcggg
     201  gctattctgc tgtgtctgag gagtgtcgat atagcttcta ccaagcattc
     251  ggcatcacac ccgaccagca gatcgcattg gagggggaga tcaagtctct
     301  caccatcaac accaatgtgg ggccccagtg tgaagcggca gattcactat
     351  ggatattgaa ccggaaatac cagtagttga aaagcaagtg ctcgctggaa
     401  atagaggaaa acaaaagaca cgtagatcgg tggccaaaga tgccatccgt
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaactt ttagtttgcc cccactggta
     551  actttaaatc agataatagc gttgtcattt tgtggtcttc tattaaacag
     601  catctctcgg gcagaaagag cttgctatta taactactct gttgatagtt
     651  ccaaacaaca acacatttca ataagtacac caaatggaaa ataaaggaga
     701  aaagatcgcg atgaatccta ctgtgcaaac attggcgcag aagggggata
     751  aattagccgt gaagttggtg acaagagggt gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctggg tacaccccag cggtcctagc
     851  ctttacaccc cgacgaccac ggatgacaaa ccctcctcca agaaccagta
     901  ggaattcacc aggacaagct ggaaagtcca tgacgatgag caagaccgaa
     951  ctattatgca ccgtcaaagg taccacaggt gttatcccaa gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt tttccctcaa ctctcgctac
    1051  tggcgactaa cttcaacaag taccgcatca ctgcgctcac tgtgaagtac
    1101  tcaccagcgt gtagcttcga gaccaatggg agggtggctc tgggattcaa
    1151  cgatgacgct tcggacacac caccaaccac caaggttggg ttttacgatc
    1201  tgggcaaaca tgtggaaact gctgcacaga cagctaagga tctagtgata
    1251  ccagtagacg gcaaaacccg gttcatcagg gactcggcta gtgatgatgc
    1301  caaactagtc gatcttggac gaatagtctt gtcaacatac gggtttgaca
    1351  aggctgacac tgtggtgggc gaattgttca tacagtacac aattgtactg
    1401  agtgacccaa ccaagacggc caaaatttca caggcaagca acgataaggt
    1451  gtcggacgga ccaacgtatg tggtcccttc ggttaatggc aacgagctgc
    1501  aactcagagt ggtagccgct gggaaatggt gcatcatagt gcggggcacg
    1551  gttgaaggag gcttcaccaa acccacactt attgggccag gaatcagcgg
    1601  taatgtagac tatgaaagtg cctgacctat cgccatttgt gagttggtga
    1651  cacaaatgga gggccagata ttgaacatca ccaagacctc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga acgcgataga aaagtttgtt
    1751  agacacgcac ggcgggacgt gttgctagag ctgccactct