Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate YXZ movement protein (P7), movement protein (P9), and coat protein (CP) genes, complete cds.

ACC No: HQ704797

Dated: 2011-07-27 | Length: 1790 | CRC: -425592559

                
ID   HQ704797; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704797;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate YXZ movement protein (P7), movement protein
DE   (P9), and coat protein (CP) genes, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="YXZ"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77604.1"
FT                   /translation="MDIEPEIPVVEKQVLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77605.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   CDS             684. .1730
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AEK77606.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAVLAFAPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVSPQLSLLAANFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASVDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVPDGPTYVVPSVNGNELQLRVVAAGN
FT                   WCIIVRGTVEGGFTKPTLIGPGISGNVDHESARPIAVCELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1790 BP; 520 A; 410 C; 475 G; 385 T; 0 other;

hq704797 Length: 1790  27-JUL-2011  Type: N  Check: 1360  ..

       1  acactggaac aacgaaacaa acgcaagaca gtggctaaag tcggtgggaa
      51  tgtgcggtct gcggattgcc gggggggttc cagttgtgca agagttctac
     101  caaaaatacg ttgaagcagc cggaaatgtg aaagagaaca agaatatcac
     151  agagaagagt agttctgggt tcttcatgat ggcggatcgc gctaagcggg
     201  gctattctgc tgtgtccgag gagtgccgat atagcttcta ccaggcattc
     251  ggcatcacac ccgaccagca gatcgcattg gagggggaga tcaagtctct
     301  taccatcaac accaatgtgg ggccccagtg tgaagcggca gattcactat
     351  ggatattgaa ccggaaatac cagtagttga aaagcaagtg ctcgctggaa
     401  ataggggaaa acaaaagaca cgtagatcgg tggccaaaga tgccatccgt
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaactt ttagtttgcc cccactggta
     551  actttaaatc agataatagc gttgtcattt tgtggtcttc tattaaacag
     601  catctctcgg gcagaaagag cttgctacta caactactct gttgatagtt
     651  ctaaacaaca acacatttca ataagtacac caaatggaaa ataaaggaga
     701  aaagatcgcg atgaatccca ctgtgcaaac attggcgcag aagggggaca
     751  agttggccgt gaagttggtg acaagagggt gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctgga tacactccag cggtcctagc
     851  cttcgcaccc cgacgaccac ggatgacgaa ccctcctcca agaaccagta
     901  ggaattcacc aggacaagct ggaaagtcca tgacgatgag taagaccgaa
     951  ctattgagca ccgtcaaagg taccacgggt gttatcccaa gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt ctcccctcaa ctctcgctgc
    1051  tggcggcgaa cttcaacaaa taccgcatca ctgcgctcac tgtgaagtac
    1101  tcacccgcgt gcagcttcga gaccaatggg agggtggctc tgggattcaa
    1151  cgacgacgct tcggacacac caccaaccac caaggttgga ttttacgatc
    1201  tgggcaaaca tgtggaaact gctgcacaga cagccaagga tctagtgata
    1251  ccagtagacg gcaaaacccg gttcatcagg gactcggcta gtgttgatgc
    1301  caaactagtc gattttgggc gaatagtctt gtcaacatac gggtttgaca
    1351  aggctgatac tgtggtgggc gaattgttta tacagtacac gattgtgctg
    1401  agtgacccaa ccaagacggc caaaatttca caggcaagca acgataaggt
    1451  gccggacgga ccaacgtatg tggtcccttc ggtcaatggc aacgagctac
    1501  aactaagagt ggtagccgct gggaattggt gcattatagt gcggggtacg
    1551  gttgagggag gcttcaccaa acccacactt attgggccag gaatcagcgg
    1601  taatgtggac catgaaagtg ccagacctat cgccgtttgt gaattggtga
    1651  cacaaatgga gggccaaata ttgaaaatca ccaagacctc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga atgcaaaaga aaagtttgtt
    1751  agacacacac ggcgggacgt gttgctagag ctgccactct