Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate YLD movement protein (P7), movement protein (P9), and coat protein (CP) genes, complete cds.

ACC No: HQ704798

Dated: 2011-07-27 | Length: 1790 | CRC: 1666217191

                
ID   HQ704798; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704798;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate YLD movement protein (P7), movement protein
DE   (P9), and coat protein (CP) genes, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="YLD"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77607.1"
FT                   /translation="MDIEPEVPVVGKQVLAGNRGEQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77608.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRADRACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   CDS             684. .1730
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AEK77609.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAVLAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLVGPGISGNVDYESARPIAICELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1790 BP; 510 A; 398 C; 480 G; 402 T; 0 other;

hq704798 Length: 1790  27-JUL-2011  Type: N  Check: 7675  ..

       1  gcattggaac agcgaaacga atgcaaagca atggctaaag tcagtaggaa
      51  tgtgcggtct gcggattgcc gggggggttc cagttgtgca agagttctac
     101  caaaaatacg ttgaaacagc cggaaatgtg aaggagaaca aaaatatcac
     151  agagaagagt agttctgggt tctttatgat ggcggatcgc gctaagcggg
     201  gctattctgc tgtgtctgag gtgtgccgat ttagcttcta ccaggcattc
     251  ggcataacgc ctgaccaaca gatcgcgttg gagggggaga ttaggcctct
     301  taccatcaac accaacgtgg ggccccagtg cgaagcggca gattcactat
     351  ggatattgaa ccggaagtac cagtggtcgg aaagcaagtg ctcgctggga
     401  ataggggaga acaaaagaca cgcagatcgg tggccaagga tgccatccgt
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaactt ttagtttgcc cccactggta
     551  actttaaatc agataatagc gttgtcattt tgtggtcttc tattgaacag
     601  catctctcgg gcagatagag cttgctatta caactactcc gttgatagtt
     651  ctaaacaaca acacatttcg ataagtacac caaatggaaa ataaaggaga
     701  gaagatcgcg atgaatccca ctgtgcaaac attggcgcag aagggggaca
     751  agttagccgt gaagttggtg acaagagggt gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctgga tacactccag cagtcctagc
     851  ctttacgccc cgacgaccac ggatgacgaa tcctcctcca agaaccagta
     901  ggaattcacc aggacaggct ggaaagtcca tgacgatgag taagaccgaa
     951  ctactatgca ccgtcaaagg taccactggt gttatcccaa gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt tttcccccaa ctctcgctgc
    1051  tggcgacaaa cttcaacaag taccgcatca ctgcgctcac cgtgaagtac
    1101  tctccagcgt gtagtttcga gaccaacggg agagtggctc tgggattcaa
    1151  cgatgacgct tcggacacac cgccaaccac caaggttgga ttctatgacc
    1201  taggcaaaca tgtggaaact gctgcacaaa cagccaagga tctagtgata
    1251  ccagtagacg gtaaaacccg gttcatcagg gactcggcta gtgatgatgc
    1301  caaactagtc gattttggac ggatagtctt gtcaacatac gggtttgaca
    1351  aggctgatac tgtggtgggc gaattgttta tacagtacac tattgtgctg
    1401  agtgacccaa ccaagacggc caaaatttca caggcaagta acgataaggt
    1451  gtcggatggg ccaacgtatg tggtcccttc ggttaatggc aacgagctac
    1501  aactaagagt ggtagccgct gggaaatggt gcattatagt gcggggtacg
    1551  gttgaaggtg gcttcaccaa acccacactt gttgggccag gaattagcgg
    1601  taatgtggac tatgaaagtg ccagacctat cgccatttgt gagttggtga
    1651  cacaaatgga gggccaaata ttgaatatca ccaagacctc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga atgcaagaga aaagtttgtt
    1751  agacacacac ggcgggacgt gttgctagag ctgccactct