Sequence of DPV Pea enation mosaic virus-2

Pea enation mosaic virus-2 strain ID RNA-dependent RNA-polymerase, 33 kDa protein, long-distance movement protein, and cell-to-cell movement protein genes, complete cds.

ACC No: JF713436

Dated: 2011-10-06 | Length: 4257 | CRC: -439519377

                
ID   JF713436; SV 1; linear; genomic RNA; STD; VRL; 4257 BP.
XX
AC   JF713436;
XX
DT   21-AUG-2011 (Rel. 109, Created)
DT   06-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Pea enation mosaic virus-2 strain ID RNA-dependent RNA-polymerase, 33 kDa
DE   protein, long-distance movement protein, and cell-to-cell movement protein
DE   genes, complete cds.
XX
KW   .
XX
OS   Pea enation mosaic virus-2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Umbravirus.
XX
RN   [1]
RP   1-4257
RX   PUBMED; 21837418.
RA   Vemulapati B., Druffel K.L., Eigenbrode S.D., Karasev A., Pappu H.R.;
RT   "Genomic characterization of pea enation mosaic virus-2 from the Pacific
RT   Northwestern USA";
RL   Arch. Virol. 156(10):1897-1900(2011).
XX
RN   [2]
RP   1-4257
RA   Vemulapati B.M., Druffel K.L., Eigenbrode S.D., Karasev A., Pappu H.R.;
RT   ;
RL   Submitted (21-MAR-2011) to the INSDC.
RL   Plant Pathology, Washington State University, 345, Johnson Hall, Pullman,
RL   WA 99164-6430, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4257
FT                   /organism="Pea enation mosaic virus-2"
FT                   /host="pea"
FT                   /strain="ID"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="2010"
FT                   /db_xref="taxon:193120"
FT   CDS             join(21. .816,816. .2569)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="RNA-dependent RNA-polymerase"
FT                   /note="RdRp; 65 kDa protein"
FT                   /protein_id="AEM45994.1"
FT                   /translation="MNCVARIKRWFTPDFTPGEGVKSRAQLERELDPTWALLVCQERAR
FT                   RDADSIANEWYEGSMECNLLIPRAKPEDVLGPSVAPEPVALVEDVTHSHAPGVDAPAEE
FT                   SSVVAEIDSVDPAEFDSLTRHLLAESNPCREMVLWVPTGLPAERDVLPRARGVIMIPEV
FT                   PASSYTLSVKVAEAVRLAQEVLASLAKRALEKRSPPTLTAQAQPEALLSGCDYPYQETG
FT                   AAAAWITPGCIAMELRAKFGICKRTPANLEMGSRVARELLRDNLCHLQGDHVVHQCHCC
FT                   GPVVDPNRRRPGLWSAGGGFLVGAVLPRLGEDTSVRFDNLHPSIEVIKAAKPRPTQRMS
FT                   YQIDVVRPLGDFGVHNNSLVNLARGINERVFYTDNARTEPLKPKVPFPSSRELRELKTF
FT                   RVTPWTMDRVVESYTGSQRTRYANARDSILSNPLSPKDARVKTFVKAEKINFTAKPDPA
FT                   PRVIQPRDPRFNIVLAKYIKPLEPMLYKALGRLYKYPAVAKGFNAVETGEIIAGKWRCF
FT                   KDPVVVGLDASRFDQHVSVEALQFTHAVYRGFIKSREFNNLLQMMYTNRGLGSAKDGFV
FT                   RYKVKGRRMSGDMDTSLGNCVLMVLLTRNLCKILGIPHELFNNGDDCIVFFDRCHLEKF
FT                   NNAVKPYFADLGFKMKVEPPVDVLEKIEFCQTQPIYDGEKWRTVRCISSIGKDCSSVIS
FT                   WDQLEGWWNAIAQSGLAVCGGMPIYTSFYRWLARAGKSGTKCQSHPLWKNEGLNWYRMG
FT                   MDLSHEVNVTPQARLSFFAGFGISPPMQVAIEALYDKLPPPSPHYGSPVKVVTQRVFTN
FT                   YFTPETACASMSTDGDNRSDFAVYGSAPTVMSLCAQC"
FT   CDS             21. .929
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /protein_id="AEM45993.1"
FT                   /translation="MNCVARIKRWFTPDFTPGEGVKSRAQLERELDPTWALLVCQERAR
FT                   RDADSIANEWYEGSMECNLLIPRAKPEDVLGPSVAPEPVALVEDVTHSHAPGVDAPAEE
FT                   SSVVAEIDSVDPAEFDSLTRHLLAESNPCREMVLWVPTGLPAERDVLPRARGVIMIPEV
FT                   PASSYTLSVKVAEAVRLAQEVLASLAKRALEKRSPPTLTAQAQPEALLSGCDYPYQETG
FT                   AAAAWITPGCIAMELRAKFGICKRTPANLEMGSRVARELLRDNCVTCRETTWYTSAIAV
FT                   DLWLTPTVVDLACGRRAADFW"
FT   CDS             2787. .3479
FT                   /codon_start=1
FT                   /product="long-distance movement protein"
FT                   /note="26 kDA protein"
FT                   /protein_id="AEM45995.1"
FT                   /translation="MTIIINVNNDERKQPEGATGSSVRRGDNKRTRGNKPRSHHPGSRE
FT                   RKGYTHPSPTPKNPRQGQLRSEAVQEHPKHGGTAFRRESGSSVHPSRPRRRARRGGDMA
FT                   PRQHPPPPRERGTKTETQAERRAQALSVLPTLLNCIGGLNLGSAEVLLHCHRAVRRQLR
FT                   TGVQPIQPVSHVESSYRSSDPQLLESSTTCSADLQNDGAGRAIGGGIPTAISEGSDVEQ
FT                   VCHASHYG"
FT   CDS             2803. .3555
FT                   /codon_start=1
FT                   /product="cell-to-cell movement protein"
FT                   /note="27 kDa protein"
FT                   /protein_id="AEM45996.1"
FT                   /translation="MSTTTSASNQKELLAALYGEVTIKELEETNLGVITPVRANEKVTL
FT                   TPLLPPKTQGRVSSVLKRFRSTRNTGGLLSVEKVVVVFTPHVPDDVLGEVEIWLHDSIL
FT                   PHLGSVGPRLKLKLSDGPKLLAFYPPYSIALGDSISGQPRSFSIATELFEGNFAPGCSP
FT                   FSLFLMWSPRIEAVTHNYLSRPPRALPICRTMVRDALSEVASQQQYLKGAMSNRYAMPL
FT                   TTGDGQHRAMKGAPSTLPPTGVCTQASK"
XX
SQ   Sequence 4257 BP; 941 A; 1154 C; 1227 G; 935 T; 0 other;

jf713436 Length: 4257  06-OCT-2011  Type: N  Check: 9582  ..

       1  gggtatttat agagatcagt atgaactgtg ttgctaggat caagcggtgg
      51  ttcacacctg acttcacccc tggcgagggt gtgaagtcca gagcacagct
     101  ggaaagagag ctggatccca cctgggcgct cctcgtgtgt caagagcgag
     151  cgcgtcggga tgctgacagt atcgccaatg agtggtacga gggcagcatg
     201  gagtgtaacc tcctcatccc tcgggctaag cccgaggacg ttttgggtcc
     251  ctccgtcgcc cctgagcctg tggctctagt ggaggatgtt acccattccc
     301  acgcgccggg cgtggatgcc cctgccgagg agtccagtgt tgtggcggag
     351  attgattccg ttgatcccgc tgagttcgac tccctcactc gtcacctgtt
     401  ggctgagtct aacccttgca gggagatggt tctgtgggtg cctactggcc
     451  taccagcaga acgtgacgtc ttgcccaggg cacgtggggt gataatgatc
     501  cccgaagtcc ctgcctcttc atacaccttg tccgtgaagg tggcagaggc
     551  tgtgcggttg gcacaggaag tcttggcatc ccttgccaag agggccttag
     601  agaaaaggtc cccaccaacc cttaccgccc aggcccagcc agaggctctc
     651  ctgtcggggt gtgactaccc atatcaggag actggagcag cagccgcatg
     701  gataacgcct ggctgcattg ccatggagct cagagccaaa tttggcatct
     751  gtaaacgaac ccccgcaaat ctagagatgg ggagtcgtgt cgcccgcgag
     801  ctcctgcggg ataactgtgt cacctgcagg gagaccacgt ggtacaccag
     851  tgccattgct gtggacctgt ggttgacccc aaccgtcgtc gacctggctt
     901  gtggtcggcg ggcggcggat ttttggtagg ggctgtgctg cctcggctgg
     951  gggaagacac tagtgtgagg tttgataacc tgcaccccag catcgaggta
    1001  atcaaggcgg ctaagccccg cccgacccag aggatgtcgt atcaaatcga
    1051  cgttgtgcgt cctcttggag attttggtgt gcacaacaac tcccttgtca
    1101  acctagccag gggaatcaat gaaagggtgt tctacacgga caatgctagg
    1151  acagaacccc taaagcctaa ggttcccttc ccgtcatcac gggagctgag
    1201  ggaactaaaa accttcagag ttaccccttg gacaatggat agggttgtgg
    1251  agagttacac tgggtcccag cgcacgcgtt atgctaacgc acgggacagc
    1301  atattatcca accccctgag tcctaaagat gcccgggtca agacgtttgt
    1351  caaagctgaa aagataaact tcacagccaa acctgacccc gcccctcgtg
    1401  tgatacagcc tagggatcca cgattcaaca ttgtcctggc taagtacatc
    1451  aagccattgg agccgatgtt gtacaaagca ttggggagac tttacaagta
    1501  tcccgcagtt gctaaggggt tcaacgcggt tgaaacgggg gagatcatcg
    1551  ctggtaagtg gcggtgcttc aaagatcccg tcgtcgtggg actagacgct
    1601  tcccggtttg atcagcatgt atctgtcgag gcgttacagt ttacccacgc
    1651  ggtgtacaga gggtttatca agtcccggga gtttaacaac ctcctgcaga
    1701  tgatgtacac caaccgtggt ctagggtctg ccaaggacgg attcgtccgg
    1751  tacaaggtca agggtagacg catgagcggt gatatggaca cctccttggg
    1801  caattgtgtg ctcatggtgt tgctcaccag gaatctctgt aagattctag
    1851  gcatcccgca tgagctcttc aacaatggtg atgattgcat cgtctttttc
    1901  gatcgctgcc acttggagaa gttcaacaat gctgtcaagc cctattttgc
    1951  agacctgggg tttaagatga aggtggagcc gccggttgac gtgctagaga
    2001  aaatagagtt ctgccaaacg cagcctatat atgacggaga gaagtggcgc
    2051  accgtgcgct gcatttcgag catcgggaaa gattgctcat ccgtcatcag
    2101  ctgggaccaa ttggaggggt ggtggaatgc catcgcccag agtggtctgg
    2151  ctgtgtgtgg cgggatgccg atatacacgt cattctaccg atggctagcg
    2201  cgggctggta aaagtgggac caagtgccag tcacacccct tatggaagaa
    2251  cgaggggttg aattggtaca ggatgggaat ggacctttct catgaggtta
    2301  atgtcacccc tcaggcgcgc ctgtctttct tcgcgggttt tggtatctcc
    2351  cccccgatgc aggtcgctat tgaggcgttg tatgacaagc tgcctccgcc
    2401  gtccccccac tatggttctc cggttaaggt tgtaacacag cgagtgttca
    2451  ccaattattt cacgccggag accgcctgtg ctagtatgag tacagatgga
    2501  gacaacagat ctgactttgc tgtgtacggc tctgcgccta cagtgatgtc
    2551  tctctgtgct cagtgttagg cttttaaaag cgatggcgtg acacggtcac
    2601  accctgaatt gacaggggat agatcaaggg aagccgggga gtcaccaacc
    2651  ccaccctgaa tcgacagggc aaaaagggaa gccgggcacc gcccacgtgg
    2701  aattgaccac gttacctttt cgcgtcgact gtgtcgtcaa cacccttttg
    2751  gcccgccagc ctaggacaat ggcggatggg taatatatga cgataatcat
    2801  caatgtcaac aacgacgagc gcaagcaacc agaaggagct actggcagct
    2851  ctgtacggcg aggtgacaat aaaagaactc gaggaaacaa acctcggagt
    2901  catcaccccg gttcgcgcga acgaaaaggt tacactcacc cctctcctac
    2951  ccccaaaaac ccaaggcagg gtcagctccg ttctgaagcg gttcaggagc
    3001  acccgaaaca cggggggact gctttccgta gagaaagtgg tagtagtgtt
    3051  cacccctcac gtcccagacg acgtgctagg agaggtggag atatggctcc
    3101  acgacagcat cctcccccac ctcgggagcg tgggaccaag actgaaactc
    3151  aagctgagcg acgggcccaa gctcttagcg ttttacccac cctactcaat
    3201  tgcattgggg gactcaatct cgggtcagcc gaggtccttc tccattgcca
    3251  ccgagctgtt cgaaggcaac ttcgcaccgg ggtgcagccc attcagcctg
    3301  tttctcatgt ggagtcctcg tatcgaagca gtgacccaca actacttgag
    3351  tcgtccacca cgtgctctgc cgatctgcag aacgatggtg cgggacgcgc
    3401  tatcggaggt ggcatcccaa cagcaatatc tgaagggagc gatgtcgaac
    3451  aggtatgcca tgcctctcac tacgggtgat ggccagcata gagccatgaa
    3501  gggggctccc agtacccttc caccaacggg ggtgtgtacc caggcttcta
    3551  agtgaggctt cgcttcccgc cggaagtccg cggcggttct gttcctccca
    3601  caggagtacg gcagcaaccc accttgggac agtggggacc ccagcactaa
    3651  cttctttaac taggcgggcg tgttggttac agtaggaggg gacagtgtgc
    3701  accaaactga gccccaccac aactcccaac cacagggtgg ttgagacgca
    3751  ggtgtcagag ggatcgccag ccctcaggat agtgagctcc cgcagaggga
    3801  taagctgtct ccctgcgacg tagtggtaga acttgtggga taggggatga
    3851  tcttgtcgac cgtttctcgg tcccctgctc cgttgagctg gcaaggcgcc
    3901  tataggttct acgttgctac taaagttggt ggtggatgtc tcgcccaaaa
    3951  agatcataaa tgcgcgggat aaggccctct ccaccttcgc cgggtaaggc
    4001  tagagtcagc gctgcatgac tataacttgc ggccgatcca gttgcacgac
    4051  tggtggtccc cctcagtgcc tcggctgtct gccgagtggg cggcggtcgg
    4101  attccgccac accctgccac gaggtgcgtg gagacttggc cagtctaggc
    4151  tcgtcgtaat tagttgcagc gacgttaatc aatccgtccg ggcatacaat
    4201  aggaccggtt gtgcttcttt ctcttttctt agccaggtgg ttacctccct
    4251  ggcgccc