Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate SP 18 coat protein gene, partial cds.

ACC No: JX207140

Dated: 2012-09-05 | Length: 1026 | CRC: 1916898940

                
ID   JX207140; SV 1; linear; genomic RNA; STD; VRL; 1026 BP.
XX
AC   JX207140;
XX
DT   05-SEP-2012 (Rel. 114, Created)
DT   05-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate SP 18 coat protein gene, partial cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1026
RA   Alexandre M.A.V., Duarte L.M.L., Harakava R.;
RT   "Identification and characterization of Brazilian isolates of Carnation
RT   mottle virus";
RL   Unpublished.
XX
RN   [2]
RP   1-1026
RA   Alexandre M.A.V., Duarte L.M.L., Harakava R.;
RT   ;
RL   Submitted (19-JUN-2012) to the INSDC.
RL   Plant Virology, Instituto Biologico, Av. Conselheiro Rodrigues Alves, 1252,
RL   Sao Paulo, SP 04150080, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1026
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="SP 18"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collected_by="M.A.V. Alexandre"
FT                   /collection_date="13-Apr-2010"
FT                   /db_xref="taxon:11986"
FT   CDS             <1. .>1026
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AFQ94059.1"
FT                   /translation="KIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAEMLAGYT
FT                   PAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSFEDWVVS
FT                   PRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVG
FT                   FYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVV
FT                   GELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVR
FT                   GTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMDGQILKITKTSAEQPLQWVVY
FT                   RM"
XX
SQ   Sequence 1026 BP; 288 A; 250 C; 273 G; 215 T; 0 other;

jx207140 Length: 1026  05-SEP-2012  Type: N  Check: 4656  ..

       1  aagatcgcga tgaatcccac tgtgcaaaca ttggcgcaga agggggacaa
      51  gttagccgtg aagttggtga caaggggttg ggcctctctg agtacgaacc
     101  agaagaggag agctgaaatg cttgctggat acactccagc gatcctagcc
     151  ttcacacccc gacgaccacg gatgacgaac cctcctccaa gaaccagtag
     201  gaattcacca ggacaagctg gaaagtccat gacgatgagt aagaccgaac
     251  tattaagcac cgtcaaaggt accaccggtg ttatcccaag ctttgaagac
     301  tgggtcgttt ccccccgaaa cgtagccgtc ttccctcaac tctcgctgct
     351  ggcgacgaac ttcaacaagt accgcattac tgcgctcact gtgaagtact
     401  cacccgcttg cagcttcgag actaatggga gggtggctct gggattcaac
     451  gatgacgctt cggatacacc accaaccacc aaggttggat tttacgatct
     501  gggcaaacat gtggaaactg ctgcacagac agctaaggat ctagtgatac
     551  cagtagacgg caaaacccgg ttcatcaggg actcggctag tgatgatgcc
     601  aaactagtcg attttggacg gatagtcttg tcaacatacg ggtttgacaa
     651  ggctgacact gtggtgggcg aattattcat acagtacacg attgtgctga
     701  gtgacccaac caagacggcc aaaatttcac aggcaagcaa cgataaggtg
     751  tcggacggac caacgtatgt ggtcccttcg gttaatggca acgagctaca
     801  actaagagtg gtagccgctg ggaaatggtg cattatagtg cggggtacgg
     851  ttgagggagg cttcaccaaa cccacactta ttgggccagg aatcagcggt
     901  gatgtggact atgaaagtgc cagacctatc gccatttgtg agttggtgac
     951  acaaatggac ggccagatat tgaaaatcac caagacctca gcagaacaac
    1001  cactccaatg ggttgtttat aggatg