Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus isolate Mg125 coat protein (CP) gene, complete cds.
ACC No: JX961587
Dated: 2012-12-16 | Length: 720 | CRC: 1177201446
ID JX961587; SV 1; linear; genomic RNA; STD; VRL; 720 BP. XX AC JX961587; XX DT 16-DEC-2012 (Rel. 115, Created) DT 16-DEC-2012 (Rel. 115, Last updated, Version 1) XX DE Rice yellow mottle virus isolate Mg125 coat protein (CP) gene, complete DE cds. XX KW . XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RC Publication Status: Available-Online prior to print RP 1-720 RX PUBMED; 23123216. RA Rakotomalala M., Pinel-Galzi A., Mpunami A., Randrianasolo A., RA Ramavovololona P., Rabenantoandro Y., Fargette D.; RT "Rice yellow mottle virus in Madagascar and in the Zanzibar Archipelago; RT Island systems and evolutionary time scale to study virus emergence"; RL Virus Res. 0:0-0(2012). XX RN [2] RP 1-720 RA Rakotomalala M., Pinel-Galzi A., Mpunami A., Randrianasolo A., RA Ramavovololona P., Rabenantoandro Y., Fargette D.; RT ; RL Submitted (11-OCT-2012) to the INSDC. RL RPB, IRD, 911 av Agropolis BP 64501, Monptellier 34080, France XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1. .720 FT /organism="Rice yellow mottle virus" FT /host="Oryza sativa" FT /isolate="Mg125" FT /mol_type="genomic RNA" FT /country="Madagascar" FT /collection_date="2010" FT /db_xref="taxon:31744" FT gene 1. .720 FT /gene="CP" FT CDS 1. .720 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /protein_id="AFZ75370.1" FT /translation="MARKGKKINSNQGQQGKKESRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNAWPVHSVEFLMDFKRSATSADAVAFNCVPFNLPRVWSLARCYSLWKPTRW FT DVVYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLNGG FT SARNAVVASMDCSRVGWRRVTSSIPSSVDPNVVNTILPARLAVRSSIKPAIDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 150 A; 184 C; 223 G; 163 T; 0 other; jx961587 Length: 720 16-DEC-2012 Type: N Check: 1157 .. 1 atggccagga agggcaagaa aatcaactcc aaccaaggcc agcaaggcaa 51 gaaggagagc cgacgtcctc gtgggcgttc ggcggagccc cagcttcaac 101 gggctccagt ggctcaggcg tcccggatat ctgggacggt tcctggacca 151 ctatcttcta atgcctggcc ggtccactcc gtggaattcc tgatggattt 201 taagcggagt gccacatcgg cggatgcggt agcatttaat tgtgtgccgt 251 ttaatctgcc tcgggtgtgg agtcttgcac gttgttactc gctgtggaag 301 ccaacacggt gggatgtggt ttacctcccc gaggtgagcg cggcgacggc 351 tggaagtatt gagatgtgtt atctctacga ctatgctgac gctatcccaa 401 gtgacacggg caagatgagc aggacggcgg gcttcgtcac ctctagcgtt 451 tggtacggcg cggagggctg ccatttgttg aatggcggct cagcacggaa 501 tgccgtggtc gcctcgatgg attgctctcg agtcggctgg agacgcgtaa 551 ctagttcaat tcctagtagc gtggatccca acgtcgtaaa taccatactg 601 ccagcaaggc tagctgtgcg gtcgtcgatc aaaccggcga ttgatgatgt 651 gccggggaaa ctctatgcca tcgtcagtat ggtcctgcgg gatccggttg 701 atccaacact caatacgtga