Sequence of DPV Cardamine chlorotic fleck virus

Cardamine chlorotic fleck carmovirus genome, replicase, coat protein, p8 protein, and p9 protein genes, complete cds.

ACC No: L16015

Dated: 2005-04-17 | Length: 4041 | CRC: -1958271027

                !!NA_SEQUENCE 1.0
ID   CDKCG      standard; genomic RNA; VRL; 4041 BP.
XX
AC   L16015;
XX
SV   L16015.1
XX
DT   04-JAN-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Cardamine chlorotic fleck carmovirus genome, replicase, coat protein, p8
DE   protein, and p9 protein genes, complete cds.
XX
KW   coat protein; complete genome; p8 protein; p9 protein; replicase;
KW   viral genome.
XX
OS   Cardamine chlorotic fleck virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4041
RX   MEDLINE; 93389449.
RX   PUBMED; 8376969.
RA   Skotnicki M.L., Mackenzie A.M., Torronen M., Gibbs A.J.;
RT   "The genomic sequence of cardamine chlorotic fleck carmovirus";
RL   J. Gen. Virol. 74(Pt 9):1933-1937(1993).
XX
RN   [2]
RP   1-4041
RA   Skotnicki M.L.;
RT   ;
RL   Submitted (11-MAY-1993) to the EMBL/GenBank/DDBJ databases.
RL   M.L. Skotnicki, Molecular Evolution and Systematics, Research School of
RL   Biological Sciences, Australian National University, Canaberra, A.C.T.
RL   2601, Australia
XX
CC   On Oct 22, 1993 this sequence version replaced gi:409253.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4041
FT                   /db_xref="taxon:31711"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cardamine chlorotic fleck virus"
FT                   /isolate="CCFV-CL"
FT   CDS             38. .2359
FT                   /codon_start=1
FT                   /db_xref="GOA:Q65987"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q65987"
FT                   /note="readthrough of stop codon at position 779-781"
FT                   /transl_except=(pos:779. .781,aa:OTHER)
FT                   /product="replicase"
FT                   /protein_id="AAB02616.1"
FT                   /translation="MDALLPEFLAHKLSRLVLKCFGIGSDEEAPQQIFVGEFPVWGGEI
FT                   VPPQPEELNQLVIPRKWVRSIGSSLNRVVLPPSSGVVASLEENCVAPFEEASVEQLEPA
FT                   SGDTGDLPRRKIRRRGRFVAHAVCAAKLHFSGCPTQTLANRLAVSKWLVQYCTERNVIP
FT                   SHTRIAVQEALPQVFLPDGHDLKEVLDLHTEEAHDRRNALRKRGRHVRRWWVQLAMHPM
FT                   TGRSWLRAWRRLTGLPDDVAVQFVRXGCLRELVGRETAISRGEHPAMRVFPLAQPPKIR
FT                   RIFHICGMGNGLDFGVHNNSLNNLRRGLMERVFYVEDAQKELKPAPQPLPDAFAKLSGI
FT                   RRKLVKLAGNHTPILREDYSKLYKGRRATIYQNACESLADRACTQGGSAELKTFVKAEK
FT                   INFTAKKDPAPRVIQPRDPRYNIEVGKYLKCYEHHLYRAIDKMWCGPTVLKGYNVEEIG
FT                   NIMSDAWNQFQKPCAIGFDMKRFDQHVSVDALKWEHSVYNASFNCPDLAKMLTWQLKNK
FT                   GVGRASDGYIKYQVEGCRMSGDVNTAMGNCLLACSITRYLMKGIKSRLINNGDDCVVFF
FT                   ESGDMHEVRERLCRWIDFGFQCIAEEPQYDLEKVEFCQMSPIYDGEGWVMVRNPRVSLS
FT                   KDSYSTTQWGSVRDAASWLASIGECGMAIAGGIPIVQSYYNCLLRNFKHLARNTSKKKL
FT                   DVSFNSGFSMLAQNGNRGSKEVSEAARYSFYVAFGYTPDEQRGLEGYYDNLALEAAWDP
FT                   EGYDETLLNRWIINPSLTTP"
FT   CDS             2326. .2541
FT                   /codon_start=1
FT                   /db_xref="GOA:Q65988"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q65988"
FT                   /product="p8 protein"
FT                   /protein_id="AAB02617.1"
FT                   /translation="MDNQSESDNSVKRRSGKKVNKQVRGSEKSATKRSVASHAARSFSQ
FT                   RPSGDSAGGNWVLVADKIEVSISFNF"
FT   CDS             2438. .2722
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q65989"
FT                   /product="p9 protein"
FT                   /protein_id="AAB02618.1"
FT                   /translation="MQLARSVNAHLAILLGVIGFWLLIRLKFQYPSISDQLPVPSPWVK
FT                   YLILSSFNSLSLVLLLCHLIPDIKPAVTYYNTTDNTKSQHISISTANGN"
FT   CDS             2712. .3767
FT                   /codon_start=1
FT                   /db_xref="GOA:Q65990"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q65990"
FT                   /product="coat protein"
FT                   /protein_id="AAB02619.1"
FT                   /translation="MAIKEDPRLVKMASLGVPWAVKVTTKGWGSLTTKQKIAARAALQI
FT                   PMRVTKQPTPKVVRVSAPAAVSYREVTGAPRVTTAGKVLTHTASELITTLKKNTSLEPK
FT                   YVEAIVNPSRVGTFNQLPDIAASYEKYKFTSLRFRYSSTCPTSTGGKVALAFERDAANP
FT                   LPDNLTAFYNLEGNTSSNPRDSFVLTVPCDNVARFVADGGSDPKLVDFGKLLAASYGQG
FT                   EGDANGLGEIHIEYTVQLYNRLGSAQRSQIGSLDGKFLGPRLVEVTSGKSDKGTKFTFS
FT                   FHGCGLIPILWLAKPRWPLTAGSAVACEVLGQSGDDSVQWAGIRISEREQTVEFEHTET
FT                   TPEAKWSVSRL"
XX
SQ   Sequence 4041 BP; 1073 A; 976 C; 1082 G; 910 T; 0 other;

   L16015  Length: 4041  May 10, 2005 10:09  Type: N  Check: 9340  ..

       1  ggttttccac gaaatccaat tcttcttctc aaccctcatg gacgctcttt
      51  taccggagtt tctcgcccac aagctttcgc gtttagtgct caaatgcttt
     101  ggtataggta gtgatgagga agcaccccag caaatctttg taggggaatt
     151  ccccgtatgg ggtggggaaa tagtcccccc ccaaccggag gagctgaatc
     201  aactagtcat tccccgtaag tgggttaggt caataggaag tagtcttaat
     251  agagtagtct taccaccctc tagtggggtt gtcgcctccc ttgaggagaa
     301  ctgtgtggca cctttcgagg aagctagcgt agaacagtta gaaccagcta
     351  gtggtgatac tggtgacctc cctaggagga agataaggag acgagggcga
     401  ttcgtcgcgc atgcggtgtg tgctgcaaag ctgcacttca gcggttgccc
     451  tacgcaaacg ctagccaacc ggttggcggt gtcgaaatgg ctggtgcagt
     501  actgcactga aagaaatgtt atacccagcc atacgagaat agctgtgcaa
     551  gaggctcttc cacaggtttt cctgcccgat gggcacgacc tgaaggaagt
     601  tctggacctt catactgaag aggcccacga caggcgaaac gcgctccgca
     651  agcgaggcag gcacgtacgt cgatggtggg ttcaattagc aatgcacccc
     701  atgactggca gatcatggct acgggcgtgg aggaggctta ccggccttcc
     751  cgacgacgtg gctgtgcaat ttgtccgcta ggggtgctta cgggaattgg
     801  ttgggcgaga gactgctatc tctcgggggg aacacccagc catgcgcgta
     851  ttcccgttag cacagccccc caaaatacga cgcatcttcc atatctgtgg
     901  aatgggcaat ggtttagact ttggagtcca caacaactca ctcaacaatc
     951  tgagaagagg tttgatggaa cgagtctttt acgtcgaaga tgcgcagaaa
    1001  gaactgaaac cagcccccca acctctaccc gacgcgttcg ctaagcttag
    1051  cggaattcgg cgcaaattgg tgaagcttgc tggaaatcat acccctatcc
    1101  ttagagaaga ctactctaag ttgtataagg gcaggagagc aaccatctac
    1151  caaaatgcgt gcgaatcatt agctgatcga gcgtgtacac aaggcgggag
    1201  cgctgagctt aaaaccttcg tcaaagctga gaagattaat tttacggcga
    1251  agaaggatcc ggcacctagg gttatccaac ctagggatcc tagatataac
    1301  atagaggtag ggaaatatct gaaatgctac gaacaccatc tttacagagc
    1351  aattgataag atgtggtgtg gtccgacagt gttgaaaggt tacaatgttg
    1401  aggagatagg gaacataatg tcagacgctt ggaaccaatt ccagaaaccg
    1451  tgtgctatag gctttgatat gaagagattc gatcagcacg tttctgtaga
    1501  tgccctcaaa tgggagcata gcgtctacaa tgccagcttt aactgtcccg
    1551  atttggccaa gatgctaacg tggcagctga agaacaaggg cgttggtagg
    1601  gcttccgatg gatacatcaa gtaccaggta gaaggatgta gaatgtcagg
    1651  tgatgtgaat acagctatgg ggaactgtct cttggcttgt tccatcactc
    1701  gttatctaat gaaggggatt aagagcagac tgatcaataa tggagacgac
    1751  tgtgttgtgt tctttgagag tggcgatatg catgaggtac gtgaaagact
    1801  gtgccgttgg atcgatttcg gattccagtg catcgccgaa gaaccgcagt
    1851  acgaccttga gaaggtagag ttttgccaaa tgtcacctat ttatgatggc
    1901  gagggatggg tcatggttag gaacccccgt gtaagcttat ccaaagacag
    1951  ctacagcacg acacaatggg gcagcgtcag agacgcagcc agctggttgg
    2001  catctatcgg agagtgcggc atggccattg caggtggcat accaatcgtg
    2051  cagtcatatt acaattgtct gctaagaaat ttcaagcatt tggcgcgaaa
    2101  tactagcaag aagaaattgg atgtttcctt taactcggga ttcagtatgt
    2151  tggcccaaaa cggcaatcgg gggtccaaag aggtttctga agcagctcgg
    2201  tactcatttt acgtggcttt cgggtacacc cctgatgaac aaaggggact
    2251  cgaaggctac tatgataatc tggcgttaga agcagcatgg gaccccgagg
    2301  gttatgatga aaccctactg aatagatgga taatcaatcc gagtctgaca
    2351  actccgtaaa gcgaagatct gggaagaagg tcaataaaca ggtgcgagga
    2401  agtgagaaga gtgcgacgaa gaggtcggtg gcgagccatg cagctcgctc
    2451  gttcagtcaa cgcccatctg gcgattctgc tgggggtaat tgggttctgg
    2501  ttgctgataa gattgaagtt tcaatatcct tcaatttctg atcagttgcc
    2551  ggtgccgtcc ccctgggtta aatacctaat cctaagcagt ttcaactctc
    2601  tctctctcgt cttactcctc tgtcatctga tacctgacat caaaccagca
    2651  gtaacatact acaacaccac tgacaacaca aaaagccaac acatctcgat
    2701  cagcaccgca aatggcaatt aaggaggacc caagattggt aaaaatggca
    2751  tcgctaggcg tcccttgggc agtgaaggtt acaacgaagg ggtggggctc
    2801  tctcaccact aagcagaaga ttgcagcacg agctgcgttg cagataccca
    2851  tgcgcgtgac gaagcagcct accccgaagg tggttcgtgt gagtgctccc
    2901  gccgcggttt cataccgtga ggtcacggga gctccacgag tcactacggc
    2951  tggtaaggtg ctgacacaca ctgcaagtga actcatcacc acgctgaaga
    3001  aaaacacctc actggagccg aagtatgtcg aagcgatcgt caacccaagc
    3051  cgggttggca catttaacca actccccgat attgcggcgt cgtacgaaaa
    3101  atacaaattc acctcactca ggttccgcta ctcgtccacg tgccctacct
    3151  caaccggagg aaaggtcgcg ctagcgtttg agcgtgacgc tgccaacccg
    3201  ctacctgaca acctgactgc gttctacaat ctagaaggca acacctccag
    3251  caacccaagg gattccttcg ttctgaccgt gccttgcgac aatgtcgcga
    3301  ggttcgtggc agacgggggc agcgacccga agctagtcga tttcggcaag
    3351  cttctggctg catcctacgg gcaaggggaa ggtgacgcca atggactggg
    3401  agaaatccac atagagtaca cagtccaact atacaaccgc ctaggttccg
    3451  cccagagaag ccaaatcggc tctctcgacg gcaagttctt gggaccgagg
    3501  ctggttgaag ttacgtcagg aaagtcagac aaaggcacca aatttacctt
    3551  cagcttccac gggtgtggtc ttatacctat cctgtggtta gcgaagcccc
    3601  gttggcccct cacagcagga tccgcagtcg cttgcgaggt cctcggccaa
    3651  tcgggagatg atagtgtgca atgggctggt ataagaatca gcgaacgtga
    3701  gcagacagtt gaatttgaac acactgagac aacaccagaa gccaaatggt
    3751  ctgtgtctcg cctgtaaagt aagtagccta acctgctgca gcaggaagta
    3801  ttctaggtag tatagtaact ctttcttcaa cttcttactt agaaaaacac
    3851  aaaaataccc ccagctcgct tttgttttga gctgtgttag ggaccaaaaa
    3901  cggcgactca tccgtcctga gtggcctctg gtgtggaaac cagagagtct
    3951  tgcggtaacc aacgaaatct cttcggagtg ggtgttgggg accaccaaat
    4001  gaagaaaata gcccctccct cgcgcagggg ggggccagcc c