Sequence of DPV Turnip crinkle virus

Turnip crinkle virus P88 protein, P28 protein, P8 protein, and coat protein genes, complete cds.

ACC No: M22445

Dated: 2005-08-26 | Length: 4050 | CRC: -909684998

                !!NA_SEQUENCE 1.0
ID   M22445     standard; genomic RNA; VRL; 4050 BP.
XX
AC   M22445;
XX
SV   M22445.2
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   26-AUG-2005 (Rel. 85, Last updated, Version 5)
XX
DE   Turnip crinkle virus P88 protein, P28 protein, P8 protein, and coat protein
DE   genes, complete cds.
XX
KW   coat protein; P28 protein; P8 gene; P88 gene.
XX
OS   Turnip crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4050
RX   PUBMED; 2718381.
RA   Carrington J.C., Heaton L.A., Zuidema D., Hillman B.I., Morris T.J.;
RT   "The genome structure of turnip crinkle virus";
RL   Virology 170(1):219-226(1989).
XX
CC   On Aug 23, 2005 this sequence version replaced gi:335192.
CC   Original source text: Turnip crinkle virus cDNA to viral RNA.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by L.A.Heaton, 08-FEB-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4050
FT                   /db_xref="taxon:11988"
FT                   /mol_type="genomic RNA"
FT                   /organism="Turnip crinkle virus"
FT                   /clone="pTCV-[103,129]"
FT                   /map="281 bp upstream of AvaI site"
FT   CDS             62. .2389
FT                   /codon_start=1
FT                   /db_xref="GOA:P17460"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17460"
FT                   /note="internal stop codon"
FT                   /transl_except=(pos:812. .814,aa:OTHER)
FT                   /product="P88 protein"
FT                   /protein_id="AAA96969.2"
FT                   /translation="MPLLHTLNTALAVGLLGARYYPEVQTFLGLPDYVGHMKNVVRSVF
FT                   QGSGLVVVSSDTVGVRGTYSNRGQIGSSLGCILAVPDSGADIEIDLDRLVGTEEEATSC
FT                   LVEAVGSTADVPRRRVRQKGRFAMHAVNAAKLHFCGVPKPTEANRLAVSKWLVQYCKER
FT                   HVVDSHIRTIVNTALPRVFTPDAEDIQVVLDLHSVRAHDHRNALAEAGKVRKWWVNLAM
FT                   HPMTGRSWSRAWRRLCRLPDDQAISFVRXGCLRELVGRETQISRGENPAMRVFPLANPP
FT                   KVRRIFHICGMGNGLDFGVHNNSLNNLRRGLMERVFYVEDAQKQLKPAPQPIPGIFGKL
FT                   SGIRRRLVRLAGNHTPVPREKYPSFYKGRRATIYQKALDLYMTCRLSRKDAELKTFVKA
FT                   EKINFTAKKDPAPRVIQPRDPRYNIEVGKYLKPYEHHLYRAIDAMWGGPTVLKGYDVGE
FT                   LGNIMSNTWDKFRKTCAIGFDMKRFDQHVSVDALRWEHSVYNAGFNCPELAQLLTWQLT
FT                   NKGVGRASDGFIKYQVDGCRMSGDVNTALGNCLLACSITKYLMKGIKCKLINNGDDCVL
FT                   FFEADEVDRVRERLHHWIDFGFQCIAEEPQYELEKVEFCQMSPIFDGEGWVMVRNPRVS
FT                   LSKDSYSTTQWANEKDAARWLAAIGECGLAIAGGVPVLQSYYSCLKRNFGPLAGDYKKK
FT                   MQDVSFDSGFYRLSKNGMRGSKDVSQDARFSFYRGFGYTPDEQEALEEYYDNLQLLCEW
FT                   DPTGYKEELSDRWILNEFPTTL"
FT   CDS             62. .814
FT                   /codon_start=1
FT                   /db_xref="GOA:P17460"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17460"
FT                   /product="P28 protein"
FT                   /protein_id="AAA96968.2"
FT                   /translation="MPLLHTLNTALAVGLLGARYYPEVQTFLGLPDYVGHMKNVVRSVF
FT                   QGSGLVVVSSDTVGVRGTYSNRGQIGSSLGCILAVPDSGADIEIDLDRLVGTEEEATSC
FT                   LVEAVGSTADVPRRRVRQKGRFAMHAVNAAKLHFCGVPKPTEANRLAVSKWLVQYCKER
FT                   HVVDSHIRTIVNTALPRVFTPDAEDIQVVLDLHSVRAHDHRNALAEAGKVRKWWVNLAM
FT                   HPMTGRSWSRAWRRLCRLPDDQAISFVR"
FT   CDS             2356. .2574
FT                   /codon_start=1
FT                   /db_xref="GOA:P17461"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17461"
FT                   /product="P8 protein"
FT                   /protein_id="AAA96970.1"
FT                   /translation="MDPERIPYNSLSDSDATGKRKKGGEKSAKKRLVASHAASSVLNKK
FT                   RNEGSASHGGTWVIVADKVEVSINFNF"
FT   CDS             2742. .3797
FT                   /codon_start=1
FT                   /db_xref="GOA:P06663"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06663"
FT                   /product="coat protein"
FT                   /protein_id="AAA96971.1"
FT                   /translation="MENDPRVRKFASDGAQWAIKWQKKGWSTLTSRQKQTARAAMGIKL
FT                   SPVAQPVQKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYT
FT                   TAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPP
FT                   NDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVDFGKLIMATYGQGAN
FT                   DAAQLGEVRVEYTVQLKNRTGSTSDAQIGQFAGVKDGPRLVSWSKTKGTAGWEHDCHFL
FT                   GTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQGVKMVTTEE
FT                   QPKGKLQALRI"
XX
SQ   Sequence 4050 BP; 1086 A; 978 C; 1109 G; 877 T; 0 other;

 M22445  Length: 4050  August 30, 2005 08:42  Type: N  Check: 6794  ..

       1  gtaatctgca aatccctgca cccgcctaaa attgccctca tcaaccttct
      51  ctctattcac gatgcctctt ctacacacac tcaacacagc gctcgcagtg
     101  ggactcctag gagccaggta ctaccctgag gttcaaacct tcttggggct
     151  gcctgactac gtgggtcaca tgaagaatgt agtacggtct gttttccagg
     201  gatctgggct agtagtagtg tcctccgaca cagtcggtgt cagggggacg
     251  tatagtaata gaggtcagat aggtagtagt ctcgggtgta tactagccgt
     301  tccggatagc ggggcggata tagaaataga cctagatagg ttggtaggaa
     351  cggaagagga agccacatcc tgtttggtgg aggcggtagg tagtaccgcg
     401  gatgtcccca ggaggagagt tcgtcaaaag gggcggtttg ctatgcatgc
     451  cgtcaacgca gcaaagctgc acttttgtgg cgtcccaaaa cccactgaag
     501  cgaatcgact agcggtctca aaatggcttg tccaatactg caaagagaga
     551  catgtcgtag acagccacat cagaacgata gtcaatacgg ctcttcctag
     601  agtgttcacg cctgacgcgg aagacattca ggtcgtgctg gatttgcaca
     651  gtgtaagagc acacgaccac cgcaacgccc tagccgaagc aggcaaagtg
     701  cggaagtggt gggtcaatct cgcgatgcat cccatgactg ggaggtcgtg
     751  gtctagggct tggaggcgat tatgccgact gcctgacgac caggcgatct
     801  cttttgtccg ctaggggtgc ttgcgggagc tggtcgggag ggagactcaa
     851  atctccaggg gtgaaaaccc ggccatgcgc gtgttcccgt tagcaaatcc
     901  cccgaaggtt cgacgcatct tccatatctg tggaatgggc aatggtttag
     951  actttggagt ccacaacaac tcactcaaca atttgagaag agggttgatg
    1001  gaaagagtct tttacgttga agatgcgcag aagcaattga aaccagcccc
    1051  ccaaccgatc ccagggattt tcgggaagtt gagtgggatt cggagacgat
    1101  tggtcaggtt ggccggaaat catacccctg tgcctcggga gaaatacccg
    1151  tcgttctaca agggcaggag ggccaccata taccaaaagg ctttggatct
    1201  ctacatgaca tgccggctat cccggaagga cgcagaactc aaaacattcg
    1251  tgaaggcaga aaagatcaat ttcacggcta agaaagaccc ggctccacgg
    1301  gtcatccagc cgagggaccc acgatataac attgaggttg ggaaatactt
    1351  gaaaccgtac gagcaccatt tatatcgggc aattgacgct atgtggggtg
    1401  ggcccactgt gctgaaagga tacgatgtgg gggagcttgg aaacattatg
    1451  agtaacacct gggataaatt ccggaaaacg tgtgcgatag gatttgacat
    1501  gaagagattc gaccagcacg tatccgtgga cgccctacga tgggaacaca
    1551  gtgtatacaa cgcgggcttt aactgtcccg agttggcaca gctgctaact
    1601  tggcagttga ccaacaaggg agttgggaga gcctccgatg gctttatcaa
    1651  ataccaagtt gatggttgtc gcatgtccgg agatgttaac acagccttgg
    1701  gcaactgcct actggcttgc tctatcacca agtacttaat gaagggaatc
    1751  aaatgcaaat taatcaacaa tggagacgat tgtgtgctgt tcttcgaagc
    1801  tgatgaagtc gacagggtgc gcgaaaggct gcatcattgg atcgactttg
    1851  ggtttcaatg catagcggaa gaaccacaat acgagttgga gaaagttgaa
    1901  ttttgccaga tgtcccctat tttcgatggt gaagggtggg tcatggtcag
    1951  aaacccccgt gtgagcctct ccaaggacag ctacagcacc acacaatggg
    2001  cgaatgagaa agatgcagcc agatggttgg ctgccatcgg agagtgtggc
    2051  ttggctattg caggtggcgt accagtgtta caatcatatt attcttgcct
    2101  gaagaggaat tttggacccc tggccgggga ctacaagaag aagatgcaag
    2151  atgtttcctt tgatagtgga ttctacaggt tatccaagaa cgggatgagg
    2201  ggcagcaaag acgtgtccca agatgctagg ttcagctttt accgggggtt
    2251  cggctacact ccagacgagc aggaagcgct tgaggagtac tacgacaacc
    2301  tgcaactgct ctgtgagtgg gaccccacgg gatataaaga agaacttagt
    2351  gatagatgga tcctgaacga attccctaca actctctaag cgacagcgac
    2401  gcaacaggaa aacggaagaa aggcggagag aaaagtgcga agaagagatt
    2451  ggtagctagc cacgcggcta gctctgtttt aaacaagaaa agaaatgaag
    2501  gttctgctag tcacgggggt acttgggtta ttgttgctga taaagtggaa
    2551  gtctcaatca acttcaactt ctaatcagac atgtcagtgc ccgacgtccc
    2601  cgtgggtaat atatgctttc tacaactctc tctcactggt cctcctactt
    2651  tgtcatctga ttcctgaaat caaaccgatt cacacatcct acaacacaca
    2701  cgactcatcg aagcagcaac acataagcat caacactgga aatggaaaat
    2751  gatcctagag tccggaagtt cgcatctgat ggcgcccaat gggcgataaa
    2801  gtggcagaag aagggctggt caaccctaac cagcagacag aaacagaccg
    2851  cccgcgcagc gatggggatc aagctctctc ctgtggcgca acctgtgcag
    2901  aaagtgactc ggctgagtgc tccggtggcc cttgcctacc gcgaggtttc
    2951  cacccagcct cgggtctcta ctgccaggga cggcataacc agaagcggtt
    3001  ctgaactgat cacaaccttg aagaagaaca ctgacactga acctaagtac
    3051  accacagctg tgcttaaccc aagcgaaccc ggaacattca accagctcat
    3101  taaggaggcg gcccagtatg aaaaataccg attcacgtca ctcagattta
    3151  ggtactcccc catgagccct tcaaccaccg gaggcaaggt ggctctggca
    3201  ttcgaccgag atgcagccaa acctccgccc aacgacctcg cttccctcta
    3251  caacatagag ggttgtgtat ctagcgtgcc ttggacaggg tttattttga
    3301  ccgtcccaac agattctact gaccgctttg tggcggatgg tatcagcgat
    3351  ccaaagcttg tcgatttcgg caagctcatc atggccacct acggccaagg
    3401  agccaatgat gccgcccaac tcggtgaagt gcgagtcgag tacaccgtgc
    3451  agctcaagaa cagaactggc tcaaccagcg acgcccagat tgggcagttc
    3501  gcaggtgtta aggacggacc caggctggtt tcatggtcca agaccaaggg
    3551  gacagctggg tgggagcacg attgtcattt tctcggaacc ggaaacttct
    3601  cgttgacatt gttctacgag aaggcgccgg tctcggggct agaaaacgca
    3651  gacgcctctg acttctcggt cctgggagaa gccgcagcag gtagtgtcca
    3701  atgggcagga gtgaaggtag cagaaagggg acaaggcgtg aaaatggtca
    3751  caactgagga gcagccaaag ggtaaattgc aagcactcag aatttagtac
    3801  ggtaatagtg tagtcttctc atcttagtag ttagctctct cttatattaa
    3851  gaaaagaaaa caaaaccccc agtcgcttta ttttgacctg tgttagggac
    3901  caaaaacggt ggcagcactg tctagctgcg ggcattagac tggaaaacta
    3951  gtgctctttg ggtaaccact aaaatcccga aagggtgggc tgtggtgacc
    4001  ttccgaacta aaagatagcc tccctcctcg cgcggggggg gggcctgccc