Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus (clones pMNS17A and pMNS01A) p29, replicase (p89), p7A, p7B, p14, capsid protein (p42) genes, complete genome.

ACC No: M29671

Dated: 2005-04-17 | Length: 4266 | CRC: -1949686400

                !!NA_SEQUENCE 1.0
ID   MNSCG      standard; genomic RNA; VRL; 4266 BP.
XX
AC   M29671;
XX
SV   M29671.1
XX
DT   25-FEB-1992 (Rel. 31, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Melon necrotic spot virus (clones pMNS17A and pMNS01A) p29, replicase
DE   (p89), p7A, p7B, p14, capsid protein (p42) genes, complete genome.
XX
KW   capsid protein; complete genome; replicase.
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RX   MEDLINE; 90063551.
RX   PUBMED; 2584953.
RA   Riviere C.J., Pot J., Tremaine J.H., Rochon D.M.;
RT   "Coat protein of melon necrotic spot carmovirus is more similar to those of
RT   tombusviruses than those of carmoviruses";
RL   J. Gen. Virol. 70(Pt 11):3033-3042(1989).
XX
RN   [2]
RP   1-4266
RX   MEDLINE; 91011332.
RX   PUBMED; 2212985.
RA   Riviere C.J., Rochon D.M.;
RT   "Nucleotide sequence and genomic organization of melon necrotic spot
RT   virus";
RL   J. Gen. Virol. 71(Pt 9):1887-1896(1990).
XX
CC   Draft entry and computer-readable [or printed] sequence for [J.
CC   Gen. Virol. (1989) In press]
CC   kindly submitted by D.A.M.Rochon, 26-OCT-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4266
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT   CDS             88. .2463
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83424"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q83424"
FT                   /note="putative replicase; internal stop codon"
FT                   /transl_except=(pos:892. .894,aa:OTHER)
FT                   /gene="p89"
FT                   /product="replicase"
FT                   /protein_id="AAB02430.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAIVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDIGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLVERVFFVEND
FT                   KKELEPAPKPLSGAFDRLTWFRRKLHSIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLKWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEIFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             88. .894
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q83423"
FT                   /gene="p29"
FT                   /function="unknown"
FT                   /product="protein 29"
FT                   /protein_id="AAB02431.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAIVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDIGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   variation       2389
FT                   /note="can be 'a' or 't'"
FT                   /gene="p89"
FT   CDS             2442. .2639
FT                   /codon_start=1
FT                   /db_xref="GOA:Q89682"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q89682"
FT                   /gene="p7A"
FT                   /function="unknown"
FT                   /product="protein p7A"
FT                   /protein_id="AAB02432.1"
FT                   /translation="MDSQRTVELTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2442. .2828
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83425"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q83425"
FT                   /note="internal stop codon"
FT                   /transl_except=(pos:2637. .2639,aa:OTHER)
FT                   /gene="p14"
FT                   /function="unknown"
FT                   /product="protein 14"
FT                   /protein_id="AAB02433.1"
FT                   /translation="MDSQRTVELTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNFXCMACCRCDSSPGDYSGALLILFISFVFFYITSLSPQGN
FT                   TYVHHFDSSSVKTQYVGISTNGDG"
FT   CDS             2643. .2828
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q89846"
FT                   /gene="p7B"
FT                   /function="unknown"
FT                   /product="protein 7B"
FT                   /protein_id="AAB02434.1"
FT                   /translation="MACCRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDS
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2815. .3987
FT                   /codon_start=1
FT                   /db_xref="GOA:P19899"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/Swiss-Prot:P19899"
FT                   /gene="p42"
FT                   /product="capsid protein"
FT                   /protein_id="AAB02435.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLANPKLVNKAIDVVPLVVQGGRK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSSDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRITYIPTTGS
FT                   TSTGRVSLLWDRDSQDPLPIDRAAISSYAHSADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGSTAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSLSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGPLTFTGNSKLVGNSLNLT
FT                   SSGASALTFTLNSTGVPNSSDSSFSVGTVVALTRVRMTITRCSPETAYLA"
FT   variation       4263. .4266
FT                   /note="cttt in wt; cgcct in variant"
XX
SQ   Sequence 4266 BP; 1057 A; 894 C; 1063 G; 1251 T; 1 other;

   M29671  Length: 4266  May 10, 2005 10:09  Type: N  Check: 3891  ..

       1  ngattactct agccggatcc ccgactctct tatttcctta agttagttcg
      51  tgtattgatt atctgtcttg atcagtatag gttagcaatg gatactggtt
     101  tgaaatttct tgtttctggg ggtttagcca cctcatctgt tattaggaaa
     151  gtgagtgctg tgagttcatt ggattcgtcc cttccttcat catctatatt
     201  atctgccatc catgggtctt ggactagtgc tatcagccac gattgtagta
     251  agattgccaa ggttgccgcc atagttggga ttggttatct tggggttagg
     301  attggtgccg cttggtgccg ccgtactccc ggaataacga attccataat
     351  cacctatggg gaagaagtgg ttgagcaagt gaaggtagat attgatgaag
     401  atgctgaaga ggagtccgat attggtgagg aaattgtggt tggtacgata
     451  ggtattggta tacacacaaa cgtcaaccct gaagttcgag ctaagcgcag
     501  acatagatcg aggccattca tcaagaagat cgtgaattta acgaagaatc
     551  acttcggtgg atgccccgac tctagtaaat cgaacgtcat ggctgtaagt
     601  aaattcgttt atgaacaatg taaacagcac aattgtcttc cacatcaaac
     651  gagattgatc atgagtattg cagttccatt ggtgttaagt cccgacatgt
     701  acgacatttc cagcaaagct ctgctaaaca gcgagatatt gacagaaaac
     751  agagccacgc tggaccgcct caaaactctc gacgggtggc taacacactt
     801  ggtgtgccac ccccttagcg cgaaggcttg gaggcgggca attgacaact
     851  tgtgtggtct tccagattgg aaggctttca agttggtcaa ctaggggtgc
     901  ctggaggagc tcgctgggtt ctgtacttcg gtacggagag ggacacaccc
     951  agacatgacc gagtttcctc aggatcgtcc cattaagaca cgcaaactgt
    1001  attgtttagg gggagttgga actagcgtga agttcaacgt gcacaataac
    1051  tctctagcta accttcggcg cggtctagtt gagcgcgttt tctttgttga
    1101  aaatgataag aaggaactgg agcctgcccc taaacctctt agtggtgcgt
    1151  ttgatcgctt aacttggttt cgtcggaaac tccatagtat tgtgggtact
    1201  cattccagta ttagtccagg tcagttcttg gacttctata ctggcaggag
    1251  gcgcacgatt tatgaaggtg ctgtgaaatc gttggagggg ttaagtgttc
    1301  aacgaaggga tgcctatctg aaaacgtttg ttaaagcgga gaagattaat
    1351  accactaaga aacctgaccc agctccgcgg gttatacaac cgaggaacgt
    1401  aagatacaac gttgaggttg gtcgttatct acgtaggttt gagcattacc
    1451  tctatcgagg aattgacgaa atctggaatg gccccaccat aataaaagga
    1501  tacactgtcg agcaaattgg gaaaatcgcc cgtgacgcat gggactcctt
    1551  cgttagtcct gtagcaatcg gatttgacat gaaaaggttc gaccaacatg
    1601  tatcctccga cgctcttaaa tgggaacata gtgtttatct tgacgctttt
    1651  tgccacgact catatcttgc agaattgttg aagtggcaat tagttaataa
    1701  gggtgttggg tatgctagtg atggaatgat taaatataag gttgatgggt
    1751  gccggatgag tggtgacatg aatacagcta tgggtaactg tttgattgcc
    1801  tgtgccatca cgcatgattt cttccgtagt cgtggtatca gggcgcgttt
    1851  gatgaacaat ggtgatgact gtgtcgtaat atgcgaaaaa gaatgtgccg
    1901  cggtggttaa agccgacatg gtaaggcact ggagacaatt cgggtttcaa
    1951  tgcgaactcg aatgcgatgc agaaatcttc gagcaaattg agttttgtca
    2001  aatgcggcct gtgtacgacg gggaaaaata tgtgatggta cggaatccct
    2051  tggttagcct atccaaagat tcctactcag tcggcccttg gaatggaatc
    2101  aaccatgcac gcaagtgggt caatgcagtt ggcttgtgtg gcttatccct
    2151  cactggtgga attcctgttg tccaaagtta ttataatatg atgatccgca
    2201  acactcagtc cgtgaacagt tctggcatac ttcgcgatgt cagttttgct
    2251  agtggatttc gggagttagc gcgattgggt aacaggaaaa gtggtgccat
    2301  atctgaagac gcccgtttta gcttttatct cgcatttggc attactccag
    2351  atttacaacg tgccatggaa agtgactatg atgctcatac tatagagtgg
    2401  ggtttcgtgc cccagggaaa tcctagaata cagccaatct catggactct
    2451  caacgaactg tagaattaac taatcctcgg ggaagaagta aagaacgtgg
    2501  tgacagcggg ggaaaacaga agaactcaat ggggcgaaag atagccaatg
    2551  atgctatctc tgaatcgaag caaggagtta tgggtgccag cacatacatt
    2601  gctgataaaa ttaaggtgac tattaacttt aatttttagt gtatggcttg
    2651  ttgccgttgt gactccagcc ccggggatta ctctggagca ttgcttatat
    2701  tatttatctc atttgttttc ttttatatta cctcgcttag cccgcaagga
    2751  aatacttacg ttcatcactt cgatagttct tccgttaaaa cacaatacgt
    2801  tggcatctct acaaatggcg atggttaaac gcattaataa tttacccaca
    2851  gtgaagcttg ctaagcaggc tctacccctg cttgcgaatc ctaaacttgt
    2901  aaataaagct atagatgtgg ttcctttggt cgtccaaggt ggtcggaaat
    2951  tgtccaaggc tgctaagcgg ttgcttggcg cttatggagg caacatttcg
    3001  tacactgagg gtgccaaacc gggtgcaata tcagctcctg tcgctattag
    3051  tcggcgagtg gctggtatga agcctaggtt tgtcagatct gaaggatctg
    3101  tgaagatagt tcatagggag tttattgcct ctgttcttcc ttcgagtgat
    3151  ctcactgtca ataatggtga tgtcaatatc ggtaagtata gagtcaatcc
    3201  tagtaataac gctttattca cctggcttca gggacaagct caactatatg
    3251  atatgtacag atttactcgg ctccgtatca cctacattcc tactaccgga
    3301  tccacttcca cgggtcgtgt ctctctcctc tgggatagag attctcagga
    3351  ccccctccct atagaccgtg ctgccattag ctcttatgct cattccgctg
    3401  attcagcgcc ttgggctgag aatgttctag tggtcccatg tgacaatacg
    3451  tggaggtaca tgaatgatac caatgctgtc gaccggaagt tggttgattt
    3501  tgggcagttc ttattcgcta cttattctgg tgctggtagc accgcccatg
    3551  gtgatcttta tgttgagtat gctgtagaat ttaaggaccc ccagcctatc
    3601  gctgggatgg tatgtatgtt tgatcgcttg gtctctcttt ccgaagttgg
    3651  atccactatc aagggtgtca attacattgc tgatcgtgat gtgataacta
    3701  ctgggggtaa tattggtgtt aacatcaata ttcccgggac ttatctcgtc
    3751  acgattgttc ttaatgctac atcgattggt cccctcacct tcactggtaa
    3801  ttctaaactt gtaggcaaca gtcttaatct taccagcagt ggtgcatctg
    3851  ctcttacgtt cacccttaac tccaccggtg tgcccaacag tagcgattct
    3901  tcattctctg tgggtaccgt tgttgccttg actagggtgc gtatgacgat
    3951  cactcgctgc tctccagaaa ctgcttacct cgcctaattt gatttactgc
    4001  actccaaatc cggtctccct tgttcctacc tgttctcagc ctgatatctg
    4051  ttctggtgtc ctataggcgt ccttgtcgtg tgtagtgcgg tctggctaac
    4101  cgtaatggcg tatcggcttg gatttccgat gatttggctc cgggatgtac
    4151  gacatagctg aagatggttg gagtttggtg gaccaccgct agcaaaatac
    4201  actctgtgtg gggcgtgcta gtggatagtc atgtatgttt gagatgggtt
    4251  ataggcccat cccttt