Sequence of DPV Pea enation mosaic virus-2

Pea enation mosaic virus-2 65kDa viral replicase gene, complete cds.

ACC No: U03563

Dated: 2002-04-27 | Length: 4253 | CRC: 1106269655

                !!NA_SEQUENCE 1.0
ID   PE03563    standard; RNA; VRL; 4253 BP.
XX
AC   U03563; S53233;
XX
SV   U03563.1
XX
DT   25-MAY-1994 (Rel. 39, Created)
DT   27-APR-2002 (Rel. 71, Last updated, Version 5)
XX
DE   Pea enation mosaic virus-2 65kDa viral replicase gene, complete cds.
XX
KW   .
XX
OS   Pea enation mosaic virus-2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Umbravirus.
XX
RN   [1]
RP   1-4253
RX   MEDLINE; 93139769.
RX   PUBMED; 8423443.
RA   Demler S.A., Rucker D.G., de Zoeten G.A.;
RT   "The chimeric nature of the genome of pea enation mosaic virus: the
RT   independent replication of RNA 2";
RL   J. Gen. Virol. 74(Pt 1):1-14(1993).
XX
RN   [2]
RX   MEDLINE; 94231179.
RX   PUBMED; 8176385.
RA   Demler S.A., Borkhsenious O.N., Rucker D.G., de Zoeten G.A.;
RT   "Assessment of the autonomy of replicative and structural functions encoded
RT   by the luteo-phase of pea enation mosaic virus";
RL   J. Gen. Virol. 75(Pt 5):997-1007(1994).
XX
RN   [3]
RP   1-4253
RA   Demler S.A.;
RT   ;
RL   Submitted (17-NOV-1993) to the EMBL/GenBank/DDBJ databases.
RL   Steven A. Demler, Botany and Plant Pathology, Michigan State University,
RL   Wilson Road, East Lansing, MI 48824-1312 USA
XX
DR   SPTREMBL; Q84693; Q84693.
DR   SPTREMBL; Q84694; Q84694.
DR   SPTREMBL; Q84695; Q84695.
DR   SPTREMBL; Q84696; Q84696.
XX
CC   On Mar 8, 1994 this sequence version replaced gi:264097.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4253
FT                   /db_xref="taxon:193120"
FT                   /organism="Pea enation mosaic virus-2"
FT                   /specific_host="Pisum sativum"
FT                   /clone="pPER2d"
FT                   /lab_host="Pisum sativum"
FT   5'UTR           1. .20
FT   CDS             21. .929
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q84693"
FT                   /function="unknown"
FT                   /product="33kDa protein"
FT                   /protein_id="AAA52183.1"
FT                   /translation="MNCVARIKRWFTPDFTPGEGVKSRAQLERELDPTWALLVCQERAR
FT                   RDADSIANEWYEGSMECNLLIPRPTTEDVFGPSIAPEPVALVEETTRSRAPCVDVPAEE
FT                   SCKSAEIDPVDLAKFDSLHRRLLAEANPCREMVLWVPPGLPAERDVLPRARGVIMIPEV
FT                   PASAHTLSVKVMEAVRLAQEVLASLAKRALEKRSTPTLTAQAQPEATLSGCDYPYQETG
FT                   AAAAWITPGCIAMELRAKFGVCKRTPANLEMGSRVARELLRDNCVTCRETTWYTSAIAV
FT                   DLWLTPTVVDLACGRRAADFW"
FT   CDS             <815. .2560
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q84694"
FT                   /note="protein is expressed as a frameshift fusion with the
FT                   first ORF on this sequence"
FT                   /function="RNA-dependent RNA polymerase"
FT                   /product="65kDa viral replicase"
FT                   /protein_id="AAA52184.1"
FT                   /translation="LCHLQGDHVVHQCHCCGPVVDPDRRRPGLWSARGGFLVGAVLPRL
FT                   GEDTSVRFDNLHPSIEVIKAARPRPTQRMSYQIDVVRPLGDFGVHNNSLVNLARGINER
FT                   VFYTDNARTEPLKPKVPFPSSRELKTFRVTPWTMDRVVESYTGSQRTRYANARDSILSN
FT                   PLSPKDARVKMFVKAEKINFTAKPDPAPRVIQPRDPRSNIVLAKYIKPLEPMLYKALGK
FT                   LYKYPAVAKGFNAVETGEIIAGKWRCFKDPVVVGLDASRFDQHVSVEALQFTHAVYRGF
FT                   IKSREFNNLLQMMYTNRGLGSAKDGFVRYKVKGRRMSGDMDTSLGNCVLMVLLTRNLCK
FT                   VLGIPHELFNNGDDCIVFFDRCHLEKFNNAVKTYFADLGFKMKVEPPVDVLEKIEFCQT
FT                   QPIYDGEKWRTVRCISSIGKDCSSVISWDQLEGWWNAIAQSGLAVCGGMPIYTSFYRWL
FT                   ARAGKSGTKCQSHPLWKNEGLNWYRMGMDLSHEVNVTPQARLSFFAGFGISPPMQVAIE
FT                   ALYDKLPPPSPHHGPPVKAVTQRVFTNYFTPESACVSMSTNEDNKSDFAVYGPVPTVMS
FT                   LCAQC"
FT   misc_difference order(2593,2643,2771,2775)
FT                   /note="Four single base changes at 2593 (C to T), 2643
FT                   (deletion), 2771 (T to A) and 2775 (T to A) between this
FT                   sequence and that of ref (1) are sufficient to permit
FT                   transcripts of the former to systemically infect its host."
FT   CDS             2763. .3473
FT                   /citation=[2]
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q84695"
FT                   /function="unknown"
FT                   /product="26kDa protein"
FT                   /protein_id="AAA52185.1"
FT                   /translation="MAVGKYMTIIINVNNDERKQPEGATGSSVRRGDNKRTRGNKPRSH
FT                   HPGSRERKGYNHPSPTPKNSKQGQLRTEAVQEHPKHGGTAFRRESGGSVHPSHPRRRAR
FT                   RGGDMAPRQHPPPPRERRTKTETQAERRAQALSVLPTLLDCIGGLDLGPAEVLLHCHRA
FT                   VRRQLRTGVQPIQPVPHVESTHRSSDPQLLESSTTCSANLQNDGAGRVIGGGIPTAIPE
FT                   GSDVEQVCHASHYG"
FT   CDS             2797. .3549
FT                   /citation=[2]
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q84696"
FT                   /function="unknown"
FT                   /product="27kDa protein"
FT                   /protein_id="AAA52186.1"
FT                   /translation="MSITTSASNQKELLAALYGEVTIKELEETNLGVITPVRANEKVTI
FT                   TPLLPPKTQSRVSSVLKRFRSTRNTGGLLSVEKVVVVFTPHIPDDVLGEVEIWLHDSIL
FT                   PHLGSVGPRLKLKLSEGPKLLAFYPPYSIALGDSISGQPRSFSIVTELFEGNFAPGCSP
FT                   FSLFLMWSPRIEAVTHNYLSRPPRALPICRTMVRDALSEVASQQQYLKGAMSNRYAMPL
FT                   TTGDGQHRAMKGAPSALPPTGVCTQASK"
FT   3'UTR           3550. .4253
FT                   /citation=[2]
FT                   /evidence=EXPERIMENTAL
FT                   /note="Sequence in this regions is highly heterogenous
FT                   between individual cDNA clones.  May be indicative of a
FT                   degenerate non-coding region."
FT   misc_feature    3842. .>4253
FT                   /note="In several alternate clones, a fifth ORF (15kDa)
FT                   begins at nt 3842 and extends off the 3' terminus (ie no
FT                   stop codon).  No functional significance can be attributed
FT                   to this ORF."
XX
SQ   Sequence 4253 BP; 953 A; 1172 C; 1206 G; 922 T; 0 other;

   U03563  Length: 4253  May 7, 2002 10:19  Type: N  Check: 4494  ..

       1  gggtatttat agagatcagt atgaactgtg tcgctaggat caagcggtgg
      51  ttcacacctg acttcacccc tggcgagggc gtgaagtcta gagctcaact
     101  ggaaagagag ctggatccca cctgggcgct tctcgtgtgc caagaacgag
     151  cgcgtcgtga tgctgacagt attgctaatg agtggtacga gggcagcatg
     201  gagtgcaacc tccttatccc tcggcccaca accgaggatg tatttggccc
     251  ctccatcgcc cctgagcctg tggctctagt ggaggaaact acccgttccc
     301  gcgcgccgtg cgtggatgtc cctgccgagg agtcctgtaa gtcagcggag
     351  attgatcctg ttgatctcgc caagttcgac tccctccatc gtcgcctgtt
     401  ggctgaagcc aacccttgca gggaaatggt tctgtgggtg cctcctggcc
     451  taccagcaga gcgcgacgtc ctgcccaggg cacgtggggt gataatgatc
     501  cccgaagtcc ctgcctctgc acataccttg tccgtgaagg ttatggaggc
     551  tgtgcggttg gcacaggaag tcttggcatc ccttgccaag agggccttag
     601  agaaaaggtc tacaccaacc cttaccgccc aggcccagcc agaggctacc
     651  ctgtcggggt gcgactaccc gtatcaggag actggagcag cagccgcgtg
     701  gataacgcct ggctgcattg ccatggagct cagagccaaa tttggcgtct
     751  gcaaacgcac ccccgcaaac ttagagatgg ggagtcgcgt cgcccgcgag
     801  ctcctgcggg ataactgtgt cacttgcagg gagaccacgt ggtacaccag
     851  tgccattgct gtggacctgt ggttgacccc gaccgtcgtc gacctggcct
     901  gtggtcggcg cgcggcggat ttttggtagg ggctgtgctg cctcggctgg
     951  gggaagacac tagtgtgcgg tttgacaacc tgcaccccag catcgaggta
    1001  atcaaggcgg ctaggccccg cccaacccag aggatgtcgt accaaatcga
    1051  cgttgtgcgt cctcttggag attttggtgt gcacaacaac tcccttgtca
    1101  acctagccag gggaattaat gaaagggtgt tctacacgga caatgctagg
    1151  acagaacccc ttaagcctaa ggttcccttc ccctcatcac gggagctgaa
    1201  aaccttcaga gtcacccctt ggaccatgga tagggttgtg gagagctaca
    1251  ctgggtccca gcgcactcgc tatgctaatg cgcgggacag catattatcc
    1301  aacccactga gtcctaaaga tgcgcgggtc aagatgtttg tcaaagctga
    1351  aaagataaat ttcacagcca aacctgaccc cgcccctcgt gtgatacagc
    1401  ctagggatcc acgatccaac attgtcctgg ctaaatacat caagcctttg
    1451  gagccaatgt tgtacaaagc actggggaaa ctttacaagt accccgcagt
    1501  tgctaagggg tttaacgcgg ttgagacggg ggagatcatc gccggcaagt
    1551  ggcggtgctt caaagatcct gtcgtcgtgg gattagacgc ttcccgattt
    1601  gatcagcatg tatctgtcga ggcgttgcag ttcacccacg cggtgtacag
    1651  agggttcatc aagtcacggg agtttaacaa cctcctacag atgatgtaca
    1701  ccaaccgtgg cctagggtcc gctaaggacg gattcgtccg ttacaaggtt
    1751  aaaggtagac gcatgagcgg tgacatggac acctccttgg gcaactgtgt
    1801  gctcatggtg ttgctcacca ggaacctttg caaggttcta ggcatcccgc
    1851  acgagctctt caacaatggt gatgattgca tcgtcttttt cgatcgttgc
    1901  cacttggaga agttcaacaa tgctgtcaag acttattttg cggacctagg
    1951  gtttaagatg aaggtggaac cgccggttga cgtgttggag aaaatagagt
    2001  tctgccaaac gcagcctatc tatgacgggg agaagtggcg caccgtgcgt
    2051  tgcatctcga gtatcggaaa agattgctca tccgttatta gttgggacca
    2101  attggagggg tggtggaatg ccatcgccca gagtggtctg gctgtgtgtg
    2151  gcggaatgcc gatatacacg tcgttctacc ggtggctagc acgggccggt
    2201  aagagtggga ccaagtgtca gtcacacccc ttgtggaaaa acgaggggtt
    2251  gaattggtac aggatgggga tggacctttc tcatgaggtt aatgttaccc
    2301  ctcaggcgcg cctgtctttc ttcgcgggtt ttggtatttc ccccccgatg
    2351  caggtcgcca ttgaggcgct gtatgacaag ctgcctccac cgtcccccca
    2401  ccatggtcct ccggttaagg ctgtaacaca gcgagtgttc accaattatt
    2451  tcacgccgga aagcgcctgt gttagcatga gcacgaatga agacaacaaa
    2501  tctgactttg ctgtttacgg ccctgtgcct acagtgatgt ctctttgtgc
    2551  tcagtgttag gctcttaaat tttagcgatg gcgtgacacg gttacaccct
    2601  gaattgacag ggtacagatc aagggaagcc ggggagtcac caacccaccc
    2651  tgaatcgaca gggcaaaaag ggaagccggg caccgcccac gtggaatcga
    2701  ccacgtcacc ttttcgcgtc gactatgccg tcaacaccct ttcggcccgc
    2751  cagcctagga caatggcggt agggaaatat atgacgataa tcattaatgt
    2801  caataacgac gagcgcaagc aaccagaagg agctactggc agctctgtac
    2851  ggcgaggtga caataaaaga actcgaggaa acaaacctcg gagtcatcac
    2901  cccggttcgc gcgaacgaaa aggttacaat cacccctctc ctacccccaa
    2951  aaactcaaag cagggtcagc tccgtactga agcggttcag gagcacccga
    3001  aacacggggg gactgctttc cgtagagaaa gtggtggtag tgttcacccc
    3051  tcacatcccc gacgacgtgc taggagaggt ggagatatgg ctccacgaca
    3101  gcatcctccc ccacctcggg agcgtcggac caagactgaa actcaagctg
    3151  agcgaagggc ccaagctctt agcgttctac ccaccctact cgattgcatt
    3201  gggggactcg atctcgggcc agccgaggtc cttctccatt gtcaccgagc
    3251  tgttcgaagg caacttcgca ccggggtgca gcccattcag cctgttcctc
    3301  atgtggagtc cacgcatcga agcagtgacc cacaactact tgagtcgtcc
    3351  accacgtgct ctgccaattt gcagaacgat ggtgcgggac gcgttatcgg
    3401  aggtggcatc ccaacagcaa tacctgaagg gagcgatgtc gaacaggtat
    3451  gccatgcctc tcactacggg tgatggccag catagagcca tgaagggggc
    3501  tcccagtgcc cttccaccaa cgggggtgtg tacccaggct tctaagtgag
    3551  gcttcgcttc ccgccggaag accgcggcgg ttctgttcct cccacaggag
    3601  tacggcaaca acccaccttg ggaaagtggg gatcccagca ctaactcctt
    3651  taactaggcg ggcgtgttgg ttacagtacg aggggacagt acgcattgaa
    3701  actgagcccc accacaactc tcatccacag ggtggttggg acgcaggtgt
    3751  cggagggatc gccagccctc aggatagtga gctcccgcag agggataagc
    3801  tgtctccctg cgacgtagta gtagaacacg tgggataggg gatgaccttg
    3851  tcgaccgttt gtcggtcccc tgctccttag agctggcaag gcgcccattg
    3901  gttctacatt tctaccaaag ttggtggtgg atgtctcgcc caaaaagatc
    3951  ataaacgcgc gggataaggc cctctccacc ttcgccgggt aaggctagag
    4001  tcagcgctgc atgactataa cttgcggccg atccagttgc acgactggtg
    4051  gtccccccca gtgtctcggt agtctgccga gtgggcggtg gtcggattcc
    4101  accacaccct gccacgaggt gcgtggagac ttggccagtc taggctcgtc
    4151  gtaattagta gcagcgacgt taatcaaccc gtccgggcat acaataggac
    4201  cggttgtgct tcttcctctc cttcttagcc aggtggttac ctccctggcg
    4251  ccc