Sequence of DPV Cowpea mottle virus

Cowpea mottle virus polyprotein genes, complete cds.

ACC No: U20976

Dated: 2002-01-28 | Length: 4029 | CRC: 849439656

                !!NA_SEQUENCE 1.0
ID   CM20976    standard; RNA; VRL; 4029 BP.
XX
AC   U20976; U07227;
XX
SV   U20976.1
XX
DT   10-JUL-1995 (Rel. 44, Created)
DT   28-JAN-2002 (Rel. 70, Last updated, Version 9)
XX
DE   Cowpea mottle virus polyprotein genes, complete cds.
XX
KW   .
XX
OS   Cowpea mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4029
RX   MEDLINE; 96068818.
RA   You X.J., Kim J.W., Stuart G.W., Bozarth R.F.;
RT   "The nucleotide sequence of cowpea mottle virus and its assignment to the
RT   genus Carmovirus";
RL   J. Gen. Virol. 76(Pt 11):2841-2845(1995).
XX
RN   [2]
RP   1-4029
RA   Stuart G.W.;
RT   ;
RL   Submitted (13-FEB-1995) to the EMBL/GenBank/DDBJ databases.
RL   Gary W. Stuart, Life Sciences, Indiana State University, Terre Haute, IN
RL   47809, USA
XX
DR   SPTREMBL; Q66123; Q66123.
DR   SPTREMBL; Q89595; Q89595.
DR   SPTREMBL; Q89761; Q89761.
DR   SPTREMBL; Q89801; Q89801.
DR   SPTREMBL; Q89875; Q89875.
DR   SPTREMBL; Q89922; Q89922.
XX
CC   On Dec 19, 1995 this sequence version replaced gi:1039368.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4029
FT                   /db_xref="taxon:12627"
FT                   /organism="Cowpea mottle virus"
FT                   /specific_host="Vigna unguiculata"
FT   CDS             35. .715
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q66123"
FT                   /note="ORF1; Method: conceptual translation supplied by
FT                   author"
FT                   /protein_id="AAC54602.1"
FT                   /translation="MLIQFGTMPPVEVQGPPRVTPWSSPSAIGKFLVGVCGGLGDAWAD
FT                   TVTRNRTTHINAFERFGEFPIEWAINSTGDEVFEPERPTREVGKGKRVINRHAKGYFLK
FT                   EAVTACRLQFNGVPMSTNANLLGVRKFLAGFCQEHGLTNQQSLRLVNAATPLVMTANQE
FT                   DVEYMKLFNCVQLNEKRAEYLDAQVVHTPIRQLVARPLSGEKWSQWIAHLGGFRPATGF
FT                   RVSN"
FT   CDS             776. .2263
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89801"
FT                   /note="putative; Method: conceptual translation supplied by
FT                   author"
FT                   /product="RNA replicase"
FT                   /protein_id="AAC54603.1"
FT                   /translation="MLITPRTGSHKVRKMGHVNFMGNGKLFGVHNASLVNLRRGLLERV
FT                   FYVEREGKLVPPPEPIPGIFSRLAGFKSKLKKIVGTHSRISDDAFVALYHGRRNTIYQN
FT                   AVDSLRIGGVQRKDSYLSTFIKAEKIPIYRKPDPAPRVIQPRNPRYNVEVGRYLRPFEH
FT                   HLYRGIDEIMGGPTVIKGYDVNQIGNIMEKASGQFVRPVAVGFDMSRFDQHVSFDALQF
FT                   EHGVYLQHFGGDRFLAKLLSWQLNNKGFANLPEGKVKYTRRGCRMSGDMNTAMGNCLLA
FT                   CAITWDLMKGIKYRLLNNGDDCVVITESKNVDFVCKQLERFRDYGFTCIAEEPVYELEK
FT                   LEFCNLHPLYDGSSWTVMRKPSVSLAKDTYCVAGWNNTKDAASWLNAIGQCGAAITGGI
FT                   PIQQAYYQCLIRNFPRGGWLQKHHHTMDSGLYWLALKKGRSDPVPVAPEARHSFYLTTG
FT                   VTPDAQIAVEEYYNNLHLALEFEPEVSPTSLSTTSAD"
FT   CDS             2287. .2496
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89922"
FT                   /note="putative"
FT                   /product="movement protein"
FT                   /protein_id="AAC54604.1"
FT                   /translation="MDQTTEVRGRSRSRQRSGSSDSRKPKNNKQVQVASEAVQRRNDKP
FT                   LRGHHGGDFVIVAHTVTLNINFNI"
FT   CDS             2411. .2677
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89595"
FT                   /note="putative; Method: conceptual translation supplied by
FT                   author"
FT                   /product="movement protein"
FT                   /protein_id="AAC54605.1"
FT                   /translation="MINHFAAITGVILLLWLIRSHSILTSIYEQNTPRVITYANLLLLL
FT                   IAYCYFCSTQSVSYVVSHSEPVVNSKVVYISVGTSPPSLQVSE"
FT   CDS             2674. .3777
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89761"
FT                   /note="Method: conceptual translation supplied by author"
FT                   /product="capsid"
FT                   /protein_id="AAC54606.1"
FT                   /translation="MNGNALTITQLAKKAATQGRASLSKNQKKRLDNANTNPIKSVTRT
FT                   ARISTRKVPAATSTTITNGVPNYAVRQNKPVIQHVELWGTLMSNTTESPAYITRTLNPS
FT                   DPATFNWVQPLSTGYDMYRLVRCEIIYTPRCAVTTTGSVVLAYDPDASDVNPDNVTDLL
FT                   NMAGAESGSAYSPLSLVPNIKQIDRYIRDNSTSDPKLVDAGKILVASYGQQTSTAPFAL
FT                   GEIRFAYTLQLIVPQPHSTGVQRLGSAPPVGRACIRTLTSVVNTTSRLADYTLTLKTAG
FT                   SYMISAVDASSHTKHKANQLWKVSSGRSYWSRATNVDIRSALKSGATITFEAATDSNAE
FT                   VYVVRDSGINDTIVVPSLHVPVNPKSL"
FT   CDS             2678. .3454
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89875"
FT                   /note="ORF6; Method: conceptual translation supplied by
FT                   author"
FT                   /protein_id="AAC54607.1"
FT                   /translation="METHSPSPSSLRKPPHRGVPHYRRIKRSGWTMQTQTPSSPSHEPH
FT                   GSPQGRSLQQPAPPSQTGCLTMRFVRTSLLSSMLSYGVLLCQILLSPLLISPGHSTQVT
FT                   QQLSTGSNPSLQGMICTDSFVVRSYTHLGVPLRRRDQWCWLMIRTLVMSILIMSPIFSI
FT                   WQVLNLVLPIALYRLSPISSRLIATFVTTALATPSLWMLGRYLLLAMASKRALHHLHSG
FT                   KSGSPTLSNSLSRNLIPLGCSGWGVPPQSVGPAFAR"
XX
SQ   Sequence 4029 BP; 1021 A; 1021 C; 1048 G; 938 T; 1 other;

 U20976  Length: 4029  February 5, 2002 12:10  Type: N  Check: 7679  ..

       1  nggtatcgtt agccagatat ccacttctct cagcatgttg atccaattcg
      51  gaacaatgcc acctgtagaa gttcaggggc ccccgagggt taccccttgg
     101  tcgagcccta gcgccatcgg caaattcctc gtcggcgtgt gtggaggcct
     151  aggtgatgcc tgggccgaca ctgtcacacg gaaccggact acgcacatca
     201  acgctttcga gcggtttggt gaattcccaa tagaatgggc aatcaatagt
     251  accggggatg aggtttttga accggaaaga cccaccagag aggtgggcaa
     301  gggcaagcgg gtcatcaata ggcacgctaa agggtacttc ctcaaagagg
     351  ccgtcactgc atgtcggctt cagttcaacg gagtgcccat gtccacgaac
     401  gccaatctgc tgggtgttcg gaagttcctt gcaggttttt gccaggaaca
     451  tgggttgacc aaccaacaat ctctgaggtt ggtcaatgct gctacacccc
     501  tcgtgatgac ggccaaccaa gaggacgtcg agtatatgaa gctgttcaac
     551  tgcgtgcagc ttaatgagaa gagggctgag tatcttgatg ctcaggtagt
     601  gcacaccccg attcgacaac tggtcgctcg ccccttgtcc ggcgagaagt
     651  ggtcacagtg gatagctcat ctgggtgggt tcagacctgc cacgggcttc
     701  cgcgtgtcca actaggggtg cctaaggcgt gtgccagggt ttaatactag
     751  tatagttcgt ggcgaacacc ctgacatgct gatcacgcct aggacaggaa
     801  gccacaaagt ccgcaaaatg gggcatgtaa atttcatggg gaacggcaag
     851  ctcttcgggg tccacaatgc aagtttagtc aaccttcgaa gagggttgct
     901  tgagcgggtg ttctatgtgg agcgcgaggg caagttagtg cccccccctg
     951  aacccattcc gggcatattt agtaggttag cggggttcaa aagcaaactg
    1001  aagaagattg tagggactca ttccaggatc agcgacgacg ctttcgttgc
    1051  tttgtatcat ggcaggagga acacaatcta tcagaatgcc gtggactcct
    1101  tacgtatagg tggagtgcag aggaaagatt catatttgag cactttcatc
    1151  aaagctgaga aaatacccat ctaccgcaag cctgaccctg ctcccagggt
    1201  gatacaaccg cgtaatccaa ggtacaatgt ggaggtgggg aggtatttac
    1251  ggccctttga gcatcatctt taccgaggca tagatgagat tatgggggga
    1301  ccgactgtga ttaaaggcta cgacgtgaac cagataggaa atatcatgga
    1351  gaaagcgtcg ggacaattcg tccgacccgt agccgtgggc tttgatatgt
    1401  cacgatttga ccaacatgtg tcctttgacg ccctccagtt tgaacatgga
    1451  gtatatttac aacattttgg aggcgaccgg ttcctggcca agttattgtc
    1501  atggcaattg aacaacaaag ggtttgccaa cttgccagaa gggaaagtca
    1551  aatacacccg ccgagggtgc aggatgagtg gggacatgaa cacagctatg
    1601  ggcaattgcc tgctggcttg tgctattacg tgggacctaa tgaaggggat
    1651  caagtaccgc ttgcttaaca acggagatga ctgtgtggtt attaccgagt
    1701  ccaagaacgt tgatttcgta tgcaagcaat tggaacgatt ccgcgactat
    1751  gggtttacgt gcatagctga ggaaccagtg tatgagttgg aaaagctgga
    1801  gttctgtaat ctacatccac tgtatgatgg ctcttcctgg acggtgatgc
    1851  ggaaaccaag cgtttcattg gctaaggaca cctattgtgt ggcaggatgg
    1901  aacaacacca aggatgcagc cagttggctc aatgccattg gtcaatgtgg
    1951  tgcagccatc acaggcggta tacccataca gcaagcgtat tatcagtgtt
    2001  taatccgcaa cttcccccgg ggtggatggt tacaaaaaca ccaccacacc
    2051  atggatagcg ggttgtattg gcttgctctc aaaaagggac gaagcgatcc
    2101  ggttccagtg gctcctgagg cacgccatag tttttactta actactggcg
    2151  tcactccgga tgcccaaata gcggtggaag agtactacaa taacctccac
    2201  cttgcgctcg agtttgaacc ggaggtatcg ccaacctcac tctcgaccac
    2251  ctcagcggac tgatttaacg tttgccaagc tcatttatgg atcaaacaac
    2301  ggaagttcgg ggtagaagca gaagccggca gcgatcaggg tccagcgact
    2351  ctcggaagcc aaagaacaat aagcaggtgc aggtagcctc ggaggccgtt
    2401  cagcgtcgaa atgataaacc acttcgcggc catcacgggg gtgattttgt
    2451  tattgtggct catacggtca cactcaatat taacttcaat atatgagcag
    2501  aacaccccca gggtaattac ctacgccaat ctcttgcttt tgttgatcgc
    2551  atattgctat ttctgctcaa cccaaagtgt tagctacgtt gtctctcact
    2601  cagaacctgt agtaaatagt aaagttgttt acatttctgt tggaacttct
    2651  cctccctctc ttcaagtgtc ggaatgaatg gaaacgcact caccatcacc
    2701  cagctcgcta agaaagccgc cacacagggg cgtgcctcac tatcgaagaa
    2751  tcaaaagaag cggctggaca atgcaaacac aaaccccatc aagtccgtca
    2801  cacgaaccgc acggatctcc acaaggaagg tccctgcagc aaccagcacc
    2851  accatcacaa acggggtgcc taactatgcg gttcgtcaga acaagcctgt
    2901  tatccagcat gttgagttat ggggtactct tatgtcaaat actactgagt
    2951  cccctgctta tatcaccagg acactcaacc caagtgaccc agcaactttc
    3001  aactgggtcc aacccctctc tacagggtat gatatgtacc gactcgttcg
    3051  ttgtgagatc atatacacac ctcggtgtgc cgttacgacg acgggatcag
    3101  tggtgctggc ttatgatccg gacgctagtg atgtcaatcc tgataatgtc
    3151  accgatcttc tcaatatggc aggtgctgaa tctggttctg cctatagccc
    3201  tctatcgctt gtccccaata tcaagcagat tgatcgctac attcgtgaca
    3251  acagcactag cgaccccaag cttgtggatg ctgggaagat acttgttgct
    3301  agctatggcc agcaaacgag cactgcacca tttgcactcg gggaaatccg
    3351  gttcgcctac actctccaac tcattgtccc gcaacctcat tccactgggg
    3401  tgcagcggtt ggggagtgcc cccccagtcg gtagggcctg cattcgcacg
    3451  ttaaccagcg tggtcaacac tacttccagg ttagctgact acacgctaac
    3501  actgaagaca gctggttcgt acatgatttc tgcggttgat gcttcctcgc
    3551  atacaaagca taaagcaaac caactttgga aggtttcgag tggaaggagt
    3601  tactggagcc gggcaaccaa tgttgatatt cgctcggccc tcaaatccgg
    3651  ggccaccatc accttcgagg ctgctactga tagtaacgcg gaggtgtatg
    3701  tcgtgcgtga cagtggcata aacgacacta ttgtcgtccc tagcctgcat
    3751  gtgccggtaa acccaaaatc tctgtgataa acttctggcc ctccatgggg
    3801  tgcgcgtccg caactttgcg cagtaccacg gacatccaga agtgccttgc
    3851  ggggcgcgtc actgaggcca aaaatagagt gtagcaactc cctctgttgg
    3901  ggagccaagt aggacctact aacaggctgt ctgagcctac ctagcgtact
    3951  gggacagaaa tccttcgggt ggggtgtcct ggaacataat cagataatga
    4001  taggggtggt agcatgccac ccccccccc