Sequence of DPV Infectious bursal disease virus

Infectious bursal disease virus structural polyprotein gene, complete cds.

ACC No: U30818

Dated: 2000-03-04 | Length: 3254 | CRC: 1176625347

                !!NA_SEQUENCE 1.0
ID   IBU30818   standard; RNA; VRL; 3254 BP.
XX
AC   U30818;
XX
SV   U30818.1
XX
DT   31-JUL-1996 (Rel. 48, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Infectious bursal disease virus structural polyprotein gene, complete cds.
XX
KW   .
XX
OS   Infectious bursal disease virus (Gumboro virus)
OC   Viruses; dsRNA viruses; Birnaviridae; Avibirnavirus.
XX
RN   [1]
RA   Dybing J.K.;
RT   "Sequence analysis of infectious bursal disease virus of serotype 2 and
RT   expression of the vp5 cdna";
RL   Thesis (1992), Pathology & Microbiology, Atlantic Veterinary College, UPEI
XX
RN   [2]
RX   MEDLINE; 91335781.
RA   Kibenge F.S., McKenna P.K., Dybing J.K.;
RT   "Genome cloning and analysis of the large RNA segment (segment A) of a
RT   naturally avirulent serotype 2 infectious bursal disease virus";
RL   Virology 184(1):437-440(1991).
XX
RN   [3]
RP   1-3254
RX   MEDLINE; 96305317.
RA   Kibenge F.S., Nagarajan M.M., Qian B.;
RT   "Determination of the 5' and 3' terminal noncoding sequences of the
RT   bi-segmented genome of the avibirnavirus infectious bursal disease virus";
RL   Arch. Virol. 141(6):1133-1141(1996).
XX
RN   [4]
RP   1-3254
RA   Kibenge F.S.;
RT   ;
RL   Submitted (03-JUL-1995) to the EMBL/GenBank/DDBJ databases.
RL   Frederick S. Kibenge, Atlantic Veterinary College, UPEI, 550 University
RL   Avenue, Charlottetown, P.E.I. C1A 4P3, Canada
XX
DR   SPTREMBL; Q82663; Q82663.
DR   SWISS-PROT; P27276; POLG_IBDVO.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3254
FT                   /chromosome="segment A"
FT                   /db_xref="taxon:10995"
FT                   /organism="Infectious bursal disease virus"
FT                   /specific_host="Gallus domesticus"
FT                   /strain="OH"
FT                   /lab_host="Colobus polykomos"
FT   repeat_unit     1. .15
FT   repeat_region   10. .41
FT   RBS             69. .79
FT   CDS             98. .535
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82663"
FT                   /note="orf"
FT                   /protein_id="AAC55350.1"
FT                   /translation="MVSRDQTNDRSDDKPDGSHPTDCSVHTEPSDANDRTGVHPGRHPG
FT                   EAHTQVRNLDLQLDCRGHRVRTNCLFPWIPWFSCRCSLHTAEQWELPVRPDAPDSAEPA
FT                   CELQLLQTSEQEPNRAVKHTPWWRLCSKWDHKRGDLPRKPE"
FT   CDS             132. .3170
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P27276"
FT                   /product="structural polyprotein"
FT                   /protein_id="AAC55351.1"
FT                   /translation="MTNLMDHTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTY
FT                   NLTVGDTGSGLIVFFPGFPGSVVGAHYTLQSSGSYQFDQMLLTAQNLPVSYNYCRLVSR
FT                   SLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDYSYNGLMSATANINDKIGNVLVGEG
FT                   VTVLSLPTSYDLSYVRLGDPIPAAGLDPKLMATCDSSDRPRVYTVTAADEYQFSSQLIP
FT                   SGVKTTLFTANIDALTSLSVGGELIFSQVTIHSIEVDVTIYFIGFDGTEVTVKAVATDF
FT                   GLTTGTNNLVPFNLGGPTSEITQPITSMKLEVVTYKRGGTAGDPISWTVSGTLAVTVHG
FT                   GNYPGALRPVTLVAYERVAAGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYT
FT                   KLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAGAFGFKDIIRAIRKIAVP
FT                   VVSTLFPPAAPLAHANREGVDYLLGDEAQAASGTARGASGKARAASGRIRQLTLAADKG
FT                   YEVVANMFQVPQNPIVDGILASPGILRGAHNLDCVSKEGATLFPVVITTLEDELTPKAL
FT                   NSKMFAVIEGAREDLQPPSQRGSFIRTLSGHRVYGYAPDGVLPLETGRDYTVVPIDDVW
FT                   DDSIMLSQDPIPPIVGNSGNLAIAYMDVFRPKVPIHVAMTGALNASEIESVSFRSTKLA
FT                   TAHRLGMKLAGPGDYDINTGPNWATFIKRFPHNPRGWDRLPYLNLPYLPPTAGRQFHLA
FT                   LAASEFKETPELEDAVRAMDAAANADPLFRSALQVFMWLEENGIVTDMANFALSDPNAH
FT                   RMKNFLANAPQAGSKSQRAKYGTAGYGVEARGPTPEEAQRAKDARISKKMETMGIYFAT
FT                   PEWVALNGHRGPSPGQLKYWQNTREIPEPNEDYPDYVHAEKSRLASEEQILRAATSIYG
FT                   APGQAEPPQAFIDEVARVYETNHGRVPNQEQMKDLLLTAMEMKHRNPRRAPPKPKPKPN
FT                   APSQRPPGRLGRWIRTVSDEDLE"
FT   repeat_region   3172. .3243
FT   stem_loop       3207. .3243
FT   repeat_unit     3240. .3254
XX
SQ   Sequence 3254 BP; 844 A; 929 C; 857 G; 624 T; 0 other;

U30818  Length: 3254  September 20, 2002 15:01  Type: N  Check: 6059  ..

       1  ggatacgatc ggtctgaacc ccgggggagt cacccgggga caggcaatca
      51  ccgccttgtt ccaggttggg actcctcctt ctgctatgct accattgatg
     101  gtgagtagag atcagacaaa cgaccgcagc gatgacaaac ctgatggatc
     151  acacccaaca gattgttccg ttcatacgga gccttctgat gccaacgacc
     201  ggaccggcgt ccatcccgga cgacaccctg gagaagcaca cactcaggtc
     251  cgaaacctcg acctacaact tgactgtcgg ggacacaggg tcaggactaa
     301  ttgtcttttt ccctggattc cctggttcag ttgtaggtgc tcactacaca
     351  ctgcagagca gtgggagcta ccagttcgac cagatgctcc tgacagcgca
     401  gaacctgcct gtgagctaca actattgcag actagtgagc aggagcctaa
     451  ccgtgcggtc aagcacactc cctggtggcg tttatgctct aaatgggacc
     501  ataaacgcgg tgaccttcca aggaagcctg agtgagttga ctgactacag
     551  ctacaacggg ctgatgtcag ccactgcaaa catcaacgac aagatcggga
     601  atgtccttgt tggggaaggg gtgactgtcc taagtctacc aacctcatat
     651  gacctcagtt atgtgaggct tggcgacccc atcccagcag caggacttga
     701  cccaaagttg atggccacgt gcgacagtag tgatagaccc agagtctaca
     751  cagtaacagc cgccgatgag taccaattct cgtcgcaact catcccaagt
     801  ggagtgaaga ctacactgtt caccgccaac atcgatgctc ttacaagcct
     851  cagtgttggt ggtgagctta tcttcagcca agtaacgatc cacagcattg
     901  aagtggacgt caccatttac ttcattgggt tcgacgggac agaggtcaca
     951  gtcaaagctg ttgcaacaga ctttgggctg acaactggga cgaacaacct
    1001  tgtgccattc aaccttggtg gtccaacaag tgagatcacc caacccatca
    1051  cttccatgaa actagaggta gtcacctata aaagaggagg cactgctggc
    1101  gatccgatat catggacagt gagcgggaca ctagctgtga cagtgcacgg
    1151  tggcaactat cctggggctc tccgtcccgt caccctagtg gcctatgagc
    1201  gagtggcagc aggatccgtc gtcacagttg caggggtgag caacttcgag
    1251  ctgatcccaa accctgagct tgccaagaac ctagtcacag aatacggccg
    1301  ctttgaccca ggagcgatga actacaccaa actaatactg agtgagagag
    1351  atcgtcttgg cataaagact gtctggccaa ccagggagta cactgacttt
    1401  agagagtact tcatggaagt tgccgatctc aactcaccct taaagattgc
    1451  aggtgcgttt ggttttaagg acataatccg agccatccgg aagattgcgg
    1501  taccagtggt atccacactc ttcccaccag ctgcacccct agcccatgca
    1551  aatcgagaag gtgtggatta ccttctgggc gatgaggcac aggcagcctc
    1601  agggacggct cgaggcgcgt caggaaaagc cagggctgcc tcaggaagaa
    1651  taaggcagct gactctcgcc gctgacaagg ggtacgaggt ggtcgccaac
    1701  atgttccagg tgccccagaa tcccattgta gatggaattc tggcatctcc
    1751  aggaatcctg cgtggtgccc acaacctcga ctgcgtgtca aaagaaggag
    1801  ccactctctt ccccgtggtc atcaccacac tcgaggatga gctgactccc
    1851  aaggcactga acagcaaaat gtttgctgtc attgaaggcg cacgagagga
    1901  ccttcaacca ccatcccaac ggggatcctt tattcgaact ctctccggcc
    1951  atagagtcta tggttacgct ccagacggtg tgctaccgct cgagacggga
    2001  agagactaca ccgttgtccc aattgatgat gtgtgggacg acagcataat
    2051  gctgtcacag gaccccatac ctccaattgt ggggaacagc ggcaacctgg
    2101  ccatagcgta catggatgtc ttcaggccta aagtccccat ccatgtggcc
    2151  atgaccgggg ccctcaacgc cagcgagatc gagagtgtaa gctttcgcag
    2201  taccaaactt gccactgccc accgacttgg catgaagttg gccggccctg
    2251  gagattatga catcaacaca gggcccaact gggcaacgtt catcaaacgt
    2301  ttccctcaca atccccgagg ctgggacagg ttgccctacc tcaacctacc
    2351  ctaccttcca ccgacagcag gacgccaatt ccacctagcc ctggcagcat
    2401  ctgagttcaa agagactccc gaacttgagg acgctgtacg tgcaatggat
    2451  gccgctgcaa acgctgaccc attgttccgc tcagcactcc aagtcttcat
    2501  gtggctggaa gaaaacggga ttgtgactga catggccaac tttgccctca
    2551  gtgacccaaa cgcacacagg atgaagaatt tcctagccaa cgctccccag
    2601  gccgggagca agtcacagag agccaagtat ggcacggcag gctacggagt
    2651  ggaggctcga ggccccacac cagaagaggc acagagggca aaagacgcgc
    2701  ggatctccaa gaagatggaa acaatgggca tctacttcgc aacgccagaa
    2751  tgggtggcac tcaatgggca tcgagggcca agtcccggcc aactcaagta
    2801  ttggcaaaac acacgagaga taccggaacc caacgaggac tatccagact
    2851  acgtgcacgc ggagaagagc cggttggcat cagaagaaca gatcttaagg
    2901  gcagccacgt cgatctacgg ggctccagga caggctgaac caccccaggc
    2951  cttcatagac gaagtagcca gggtctatga aacaaaccac gggcgtgtcc
    3001  caaaccaaga gcagatgaag gacctgctct tgactgcgat ggagatgaag
    3051  catcgcaatc ccaggcgggc tccaccaaag ccgaagccaa aacccaatgc
    3101  tccatcacag aggccccctg gtcggctggg ccgctggatc aggacggtct
    3151  ctgacgagga cttggagtga ggctcctggg agtctcccga caccacccgc
    3201  gcaggtgtgg acaccaattc ggccctatac catcccaaat ggatcgttcg
    3251  cggt