Sequence of DPV Panicum mosaic virus

Panicum mosaic virus (PMV) Kansas strain infectious clone, complete sequence.

ACC No: U55002

Dated: 1998-12-23 | Length: 4326 | CRC: 834182997

                !!NA_SEQUENCE 1.0
ID   PMU55002   standard; RNA; VRL; 4326 BP.
XX
AC   U55002;
XX
SV   U55002.1
XX
DT   20-JAN-1997 (Rel. 50, Created)
DT   23-DEC-1998 (Rel. 58, Last updated, Version 6)
XX
DE   Panicum mosaic virus (PMV) Kansas strain infectious clone, complete
DE   sequence.
XX
KW   .
XX
OS   Panicum mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-4326
RX   MEDLINE; 98122999.
RA   Turina M., Maruoka M., Monis J., Jackson A.O., Scholthof K.-B.G.;
RT   "Nucleotide sequence and infectivity of a full-length cDNA clone of panicum
RT   mosaic virus";
RL   Virology 241(1):141-155(1998).
XX
RN   [2]
RP   1-4326
RA   Scholthof K.-B.G., Turina M.;
RT   ;
RL   Submitted (12-APR-1996) to the EMBL/GenBank/DDBJ databases.
RL   K.-B. G. Scholthof, Plant Pathology, Texas A&M University, 120 Peterson
RL   Building, College Station, TX 77843-2132, USA
XX
DR   SPTREMBL; P89034; P89034.
DR   SPTREMBL; P89035; P89035.
DR   SPTREMBL; P89036; P89036.
DR   SPTREMBL; P89037; P89037.
DR   SPTREMBL; P90334; P90334.
DR   SPTREMBL; P90335; P90335.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4326
FT                   /db_xref="taxon:40279"
FT                   /note="PMV is a member of the provisional group
FT                   'Panicovirus' within the family Tombusviridae; Virus is
FT                   maintained by mechanical transmission to Pennisetum
FT                   glaucum"
FT                   /organism="Panicum mosaic virus"
FT                   /strain="Kansas"
FT   CDS             29. .1306
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:P90334"
FT                   /note="p48; putative"
FT                   /product="48 kDa replicase protein"
FT                   /protein_id="AAC97552.1"
FT                   /translation="MESLIQHILSATSSLSMPSVDSDKLQLLLTRFPQATLSWLSGIDG
FT                   LSVHQFKVVATHVIKESYSHLSPSVAVLLAKPSDYYKLVVHGLTQKQWNEFDDKVTDAP
FT                   RTAISWLYNQILVVGQPWMKSLNEGLKEYLPGWLHTCLRMLANLWFGAERVLHGISHAV
FT                   SDITTYQPWMSCRRCVAHSPKESLLGEATTTSNPRESSWFSWLLCGGVVAATVYGFYKW
FT                   VTITETIDRQDLAKQRPTHMQKCYEEVKARLEEESKGFIHDRMEDELTKIVLEPAEIDN
FT                   DGKVLKSEVAQYLVKNHGRFVRSLVTMAKNEFAGVPKPTEANQLAVWRYLYRVCDKKGV
FT                   NPSDTQKSISAALPFVFLPSAYDQDQAITMNCDDTKKVLERYADTFRHTTPLQKLVTNP
FT                   LVGANWTAWARSIFISDPETGLRFAK"
FT   CDS             29. .3007
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:P89034"
FT                   /note="p112 is a putative readthrough protein of p48 ORF"
FT                   /transl_except=(pos:1304. .1306,aa:OTHER)
FT                   /product="112 kDa replicase protein"
FT                   /protein_id="AAC97551.1"
FT                   /translation="MESLIQHILSATSSLSMPSVDSDKLQLLLTRFPQATLSWLSGIDG
FT                   LSVHQFKVVATHVIKESYSHLSPSVAVLLAKPSDYYKLVVHGLTQKQWNEFDDKVTDAP
FT                   RTAISWLYNQILVVGQPWMKSLNEGLKEYLPGWLHTCLRMLANLWFGAERVLHGISHAV
FT                   SDITTYQPWMSCRRCVAHSPKESLLGEATTTSNPRESSWFSWLLCGGVVAATVYGFYKW
FT                   VTITETIDRQDLAKQRPTHMQKCYEEVKARLEEESKGFIHDRMEDELTKIVLEPAEIDN
FT                   DGKVLKSEVAQYLVKNHGRFVRSLVTMAKNEFAGVPKPTEANQLAVWRYLYRVCDKKGV
FT                   NPSDTQKSISAALPFVFLPSAYDQDQAITMNCDDTKKVLERYADTFRHTTPLQKLVTNP
FT                   LVGANWTAWARSIFISDPETGLRFAKXGCIEKWQGVQCKRTRVRHPRLRCHFKDRDPKV
FT                   RSIYRIAGLGDQYEFGLHNNSAANLERGLAERVYMVKNYKTDFVASLDPAFCPAPEPVR
FT                   GIFKRLDKYKKEIVRRVGRKSPITDEMFLSYYDGPQLTTYSKAVISLSERPVAVQDSYL
FT                   KTFIKAEKLNLTLKTDPCPRVIQPRHPRYNVELGKYLKHIEHPIYKAIDRIWGGKTIFK
FT                   GMNVEAMGAEIHKKMCKYSNPCAIGFDASRFDQHVSVEALRFEHSIYKSIHGYPELLSL
FT                   LLKWQIHNQGTAHTNDGFFKYLVDGKRMSGDMNTSLGNCILASLIVKDLVDSLGVDAQL
FT                   VNNGDDNVLICSVDDEEVVVKALYDHWMKYGFEVVAEQPVYITEQIEFCQMKPVFDGTQ
FT                   YVLVRNPTVTMSKDACSITPFYTANSARKWCRAVGEAGLSLTGGMPIKQAYYQCMIRNG
FT                   INKGNIHKSKEFRYGLSYVLHHGKSDRKARPISAATRYSFYLAFGYTPDEQTALEGYYD
FT                   SLELEWTESRLGIPARTPECLLLRLLPKIPLQPKSPTKPVQRTASKPDLPDSQWQQALA
FT                   APL"
FT   CDS             2875. .3096
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:P90335"
FT                   /note="8 kDa putative ORF"
FT                   /product="p8"
FT                   /protein_id="AAC97553.1"
FT                   /translation="MSTVETPAQDTLATKEPNKTGAKDRQQARSARLSVAAGAGRTALS
FT                   QRDAQEDRFSLGIVQTADKIENTFNFNF"
FT   CDS             join(2875. .3093,3096. .3275)
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:P89035"
FT                   /note="putative 14.6 kDa protein; shares amino terminus
FT                   with p8 (putative 8 kDa protein); putative -1 frameshift"
FT                   /product="p8-FS"
FT                   /protein_id="AAC97554.1"
FT                   /translation="MSTVETPAQDTLATKEPNKTGAKDRQQARSARLSVAAGAGRTALS
FT                   QRDAQEDRFSLGIVQTADKIENTFNFNFVATGKCYCPEDPRVGPLLVLCLLLLLILFSR
FT                   SWNVAPVVVPSYHTVYHHEKYQNIEIQK"
FT   CDS             3272. .4000
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:P89036"
FT                   /product="26 kDa capsid protein"
FT                   /protein_id="AAC97555.1"
FT                   /translation="MNRNGATPTRGRGKRAIPNPPRRRARGKSVERGSTPLQYVTTLGP
FT                   SRPRMGQGQGWQKLSHEEIILQVNSSTAADTIQTIPIIPRLSVPAGDKPIYSGSAPHLR
FT                   TIGSAFAIHRWRALSFEWIPSCPTTTPGNLVLRFYPNYSTETPKTLTDLMDSESLVLVP
FT                   SLSGKTYRPKIETRGNPPELRNIDATAFSALSDEDKGDYSVGRLVVGSSKQAVVIQLGL
FT                   LRMRYSAEMRGATSISGVSA"
FT   CDS             3282. .3680
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:P89037"
FT                   /note="putative; Gene nested within 26 kDa capsid protein
FT                   ORF"
FT                   /product="15 kDa protein"
FT                   /protein_id="AAC97556.1"
FT                   /translation="MELPLPEDVASVLYLTPLAAVREVNLWNGAPPPYSMLQLWARVDH
FT                   AWAKDRVGRSYPTRKSYFKSTRLLPRTLYRQYQSYRDCQCLQETSPFTREVHHTCVQLD
FT                   PLSPSTDGEHSPSSGSPAVLRQHREIWF"
XX
SQ   Sequence 4326 BP; 1216 A; 1113 C; 1051 G; 946 T; 0 other;

U55002  Length: 4326  December 21, 2001 15:59  Type: N  Check: 5411  ..

       1  gggtattggc tgcaacccat acctgaagat ggagtcgctc atacagcaca
      51  ttctctctgc tacatcttcg ctttccatgc catcagtgga cagtgacaaa
     101  ctgcaactac tacttacacg cttcccacag gctacactct catggctgag
     151  tggaatagac ggcctaagcg tgcatcaatt caaggtagtg gctacccacg
     201  taatcaagga aagctattcc catctctcac cttccgttgc agtgttgctg
     251  gcgaagccca gtgactacta caagctggtg gtccacggac tcacccaaaa
     301  gcaatggaac gagtttgacg ataaagtcac agacgctccg cggaccgcta
     351  tatcatggtt atacaaccaa attttggtag ttggacagcc atggatgaag
     401  agtctgaacg agggattaaa ggaatacctg ccaggttggc ttcacacctg
     451  tctaagaatg ctagccaatc tgtggttcgg ggctgaaaga gttctacatg
     501  gcatttcaca cgccgtcagt gacatcacta catatcaacc atggatgtca
     551  tgtcggagat gtgtcgcaca tagccccaaa gagagcttgc taggcgaggc
     601  aaccaccacc tccaaccccc gagagtcttc ttggttttca tggttgttgt
     651  gcggaggagt ggtagcggca acggtatatg gattctacaa atgggttacc
     701  atcacggaga ccattgaccg ccaggaccta gcaaaacaga ggcccactca
     751  tatgcagaag tgctatgaag aagtgaaggc ccgactagag gaggaaagca
     801  aagggttcat tcacgaccgg atggaagacg aactcaccaa aatcgtgcta
     851  gagccagctg aaattgacaa tgacggcaaa gtgcttaaat ctgaggtggc
     901  acaatacctg gttaaaaatc atggccgttt cgtccgctcc ctagtaacaa
     951  tggcaaagaa cgaattcgct ggggttccaa aacccacaga ggctaaccag
    1001  ttggctgtct ggagatacct ctacagggtg tgtgataaga aaggagttaa
    1051  cccctcggac acacagaaaa gcatatccgc tgccttgcca tttgtattcc
    1101  tgcctagcgc atacgaccag gatcaggcca tcactatgaa ctgtgatgac
    1151  accaagaaag tgcttgagcg ctatgcagac acatttcgac acaccacccc
    1201  actgcaaaaa ctagtgacca atccattagt tggggccaat tggactgctt
    1251  gggcaagatc catttttatc tcggacccgg aaacgggtct gaggtttgcc
    1301  aagtaggggt gtatcgaaaa gtggcagggg gtccagtgca agcgcactcg
    1351  ggtccgacac ccccgtctca gatgccactt taaagatagg gaccccaagg
    1401  tacgcagtat ttaccgtatc gctggactgg gcgatcagta tgagtttggg
    1451  cttcacaaca acagtgctgc gaaccttgaa aggggcttag ccgaaagggt
    1501  gtacatggtc aagaattaca agacagactt tgtagcctca cttgaccctg
    1551  cgttttgccc tgccccagaa ccagtcagag gcatattcaa acgcctagac
    1601  aaatacaaga aggagattgt gagacgagtc ggtaggaaga gtccaatcac
    1651  tgacgagatg ttcctttctt actatgatgg tccccagttg accacttata
    1701  gcaaggctgt gatttccttg tccgaacgcc ctgtggctgt ccaagactca
    1751  tatcttaaaa ccttcatcaa ggcggagaaa ttaaacctca cactcaagac
    1801  agacccctgt cctagggtca tacaaccacg tcaccccaga tacaatgtcg
    1851  agttgggtaa gtatctcaag cacatagaac acccaatcta taaagccata
    1901  gacagaatat ggggggggaa gacaatattt aaaggcatga atgtagaggc
    1951  tatgggcgcc gaaatccaca agaaaatgtg caaatactcc aacccttgcg
    2001  caataggatt tgacgcctcc cgtttcgatc agcacgtatc tgtagaagcg
    2051  ctaagatttg agcactccat ctacaaatct attcacggat accctgaact
    2101  gcttagtcta ctactcaaat ggcaaatcca caaccagggc actgcacaca
    2151  ccaatgatgg atttttcaag tacttagtag acggaaagag gatgtctggt
    2201  gacatgaaca ccagtctggg aaactgcatt ttggcatcgc taatagtgaa
    2251  agacttggtt gacagtctag gcgttgatgc tcaactcgtc aacaatggag
    2301  acgacaatgt cctaatctgc tcggtggatg atgaggaagt ggtagtcaag
    2351  gcattgtacg accattggat gaagtatggg tttgaggtcg tagcagagca
    2401  accagtctat atcacagagc aaatagaatt ctgccaaatg aagccagttt
    2451  ttgacggaac ccagtatgtc ctcgtcagaa acccaactgt taccatgagt
    2501  aaagatgcgt gcagcattac tcctttttac acagcgaaca gcgctcgcaa
    2551  atggtgtaga gcagttggag aagcaggatt aagtctgaca ggtggtatgc
    2601  ccatcaaaca agcgtattac cagtgcatga ttcgaaacgg cattaacaag
    2651  ggtaacatcc acaagtcaaa ggagtttagg tacgggttat cttacgtgct
    2701  acaccacggc aaatccgacc ggaaggcccg ccccatttca gcggcgacca
    2751  gatattcatt ctaccttgca tttggctaca ctcctgacga gcaaacagcc
    2801  ttggaaggtt attatgactc ccttgaattg gagtggaccg aatccaggtt
    2851  gggtattcct gcaagaacgc ccgaatgtct actgttgaga ctcctgccca
    2901  agataccctt gcaaccaaag agcccaacaa aaccggtgca aaggaccgcc
    2951  agcaagccag atctgccaga ctctcagtgg cagcaggcgc tggccgcacc
    3001  gctttaagcc aacgagacgc acaagaagac aggttcagcc taggaattgt
    3051  tcaaactgct gacaagattg aaaatacttt caacttcaat ttctagtggc
    3101  gaccggcaag tgctattgtc ccgaggaccc aagagttggg cccctcctag
    3151  tactctgcct acttctatta ctgatcctgt tttcacggtc gtggaacgta
    3201  gctccagtgg tggttccctc ataccacaca gtgtaccatc acgagaaata
    3251  ccaaaacatt gagatccaga aatgaatcgc aatggagcta cccctaccag
    3301  aggacgtggc aagcgtgcta tacctaaccc ccctcgccgc cgtgcgagag
    3351  gtaaatctgt ggaacggggc tccacccccc tacagtatgt tacaactctg
    3401  ggcccgagta gaccacgcat gggccaagga cagggttggc agaagttatc
    3451  ccacgaggaa atcatacttc aagtcaactc gtctactgcc gcggacacta
    3501  tacagacaat accaatcata ccgcgattgt cagtgcctgc aggagacaag
    3551  cccatttact cgggaagtgc accacacctg cgtacaattg gatccgcttt
    3601  cgccatccac agatggcgag cactctcctt cgagtggatc cccagctgtc
    3651  ctacgacaac accgggaaat ctggttttga ggttctatcc gaactacagc
    3701  acggaaacac ctaagaccct cacagacctg atggacagcg aatccctcgt
    3751  gttagtccct tccctctccg ggaaaactta ccgccctaag atcgaaacac
    3801  gaggaaaccc accggaattg cgcaacatag atgccaccgc tttctccgct
    3851  ctcagcgacg aagataaggg tgactactcg gtgggaaggc tggttgttgg
    3901  ctccagcaaa caagctgtcg tgatacagct cggactcctc cgcatgagat
    3951  actcagctga aatgcgggga gcaacctcca tcagtggggt tagcgcataa
    4001  acctgcccaa ggttatcaca ggctaggacc ggcctgataa aggtccgact
    4051  tgatgtgcag cttcttaggt gcatctcgta tagaagcgct ctggacatga
    4101  cacctttgag acagaccgta cagcagtcac acgggacgcc acaccacctt
    4151  tgcagaggtg cccttgggaa accaatggtg tggggtgaca ctgattagtc
    4201  gttaacggtg tactaatcca gagtagttca gtgcagggga aacccgggcc
    4251  gtaagcacgt ggaactatat aacttaatct cgctgagaag attggggggg
    4301  attcatgaaa tcccctcacc aggccc