Sequence of DPV Sugarcane mosaic virus
Sugarcane mosaic virus strain B polyprotein mRNA, partial cds.
ACC No: U57355
Dated: 2006-11-14 | Length: 1989 | CRC: -615398758
ID U57355; SV 1; linear; mRNA; STD; VRL; 1989 BP.
XX
AC U57355;
XX
DT 06-FEB-1997 (Rel. 50, Created)
DT 14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE Sugarcane mosaic virus strain B polyprotein mRNA, partial cds.
XX
KW .
XX
OS Sugarcane mosaic virus
OC Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC Potyvirus.
XX
RN [1]
RP 1-1989
RA Mirkov T.E., Yang Z.N.;
RT "Sequence and relationships of Sugarcane Mosaic and Sorghum Mosaic Virus
RT strains, and development of RT-PCR based RFLPs for strain discrimination";
RL Phytopathology 87:932-939(1997).
XX
RN [2]
RP 1-1989
RA Mirkov T.E.;
RT ;
RL Submitted (02-MAY-1996) to the EMBL/GenBank/DDBJ databases.
RL T. Erik Mirkov, Plant Pathology, Texas A&M, 2415 E. Hwy 83, Weslaco, TX
RL 78596, USA
XX
FH Key Location/Qualifiers
FH
FT source 1. .1989
FT /organism="Sugarcane mosaic virus"
FT /strain="B"
FT /mol_type="mRNA"
FT /db_xref="taxon:12224"
FT mat_peptide <1. .828
FT /product="nuclear inclusion II protein"
FT CDS <1. .1758
FT /codon_start=1
FT /product="polyprotein"
FT /db_xref="GOA:P89205"
FT /db_xref="InterPro:IPR001205"
FT /db_xref="InterPro:IPR001592"
FT /db_xref="InterPro:IPR007094"
FT /db_xref="UniProtKB/TrEMBL:P89205"
FT /protein_id="AAB70859.1"
FT /translation="CDADGSQFDSSLTPYLINAVLHIRLQFMEEWELGAQMLRNLYTEI
FT VYTPIATPDGSIIKKFKGNNSGQPSTVVDNTLMVILAFNYAMLSSGIQDNEIDNCCKMF
FT ANGDDLLLAVHPDYEHILDGFQTHFGNLGLNFEFNSRTKEKSNLWFMSTQGLKCEGIYI
FT PKLEKERIVAILEWDRSNLPEHRLEAICAAMVEAWGYPDLIHEIRKFYAWLLEMQPFAN
FT LAKEGLAPYIAETALRNLYLGSGIKEEEIEKYFKQFAKDLPGYLEDYNEEVFHQAGTVD
FT AGAQGGGGNAGTQPPATGAAVQGGAQPPATGAAAQPPAAQPTGGATGGGSAQTGAGGTG
FT SITGGQRDKDVDAGTTGKITVPKLKAMSKKMRLPKAKGKDVLHLDFLLTYKPQQQDISN
FT TRATREEFDRWYEAIKKEYEIDDTQMTVVMSGLMVWCIENGCSPNINESWTMMDGDEQR
FT VFPLKPVIENASPTFRQIMHHFSDAAEAYIEYRNSTERYMPRYGLQRNLTDYSLARYAF
FT DFYEMNSRTPARAKEAHMQMKAVAVRGSNTRLFGLDGNVGETQENTERHTAGDVSRNMH
FT SLLGVQQHH"
FT variation 3
FT /replace="t"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 6
FT /replace="t"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 9
FT /replace="t"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 15
FT /replace="t"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 72
FT /replace="a"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 99
FT /replace="g"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 144
FT /replace="g"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 576
FT /replace="a"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 753
FT /replace="t"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT mat_peptide 829. .1755
FT /product="coat protein"
FT variation 905
FT /replace="c"
FT /note="nucleotide difference between two independent clones
FT for this strain; results in amino acid change from V to A"
FT variation 991
FT /replace="g"
FT /note="nucleotide difference between two independent clones
FT for this strain; results in amino acid change from S to G"
FT variation 1340
FT /replace="g"
FT /note="nucleotide difference between two independent clones
FT for this strain; results in amino acid change from E to G"
FT variation 1465
FT /replace="a"
FT /note="nucleotide difference between two independent clones
FT for this strain; results in amino acid change from E to K"
FT variation 1487
FT /replace="a"
FT /note="nucleotide difference between two independent clones
FT for this strain; results in amino acid change from R to Q"
FT variation 1619
FT /replace="c"
FT /note="nucleotide difference between two independent clones
FT for this strain; results in amino acid change from V to A"
FT 3'UTR 1759. .1989
FT variation 1942
FT /replace="a"
FT /note="nucleotide difference between two independent clones
FT for this strain"
FT variation 1950
FT /replace="c"
FT /note="nucleotide difference between two independent clones
FT for this strain"
XX
SQ Sequence 1989 BP; 633 A; 423 C; 482 G; 451 T; 0 other;
u57355 Length: 1989 14-NOV-2006 Type: N Check: 488 ..
1 tgcgacgcgg atggctcaca atttgacagc tccttaacac catatctcat
51 aaatgccgtg ctacacattc ggttacaatt tatggaggag tgggaattag
101 gcgcacaaat gttacgaaat ctgtacactg agatcgtcta cacaccaatt
151 gcaacaccag atggttccat aatcaagaaa tttaaaggaa acaacagtgg
201 tcaaccatca actgtagtcg acaacacgct aatggtcatc ttagcattca
251 attatgcaat gttgtcaagt ggaatacaag acaatgaaat tgacaactgt
301 tgcaaaatgt ttgctaatgg agatgatcta ctgttggcag tacatcccga
351 ttatgaacat atactggatg gctttcagac ccactttgga aaccttggtt
401 taaattttga attcaattca cgaacgaagg aaaaatcgaa tttgtggttc
451 atgtcaacac agggactcaa gtgtgagggc atttacatac caaaactcga
501 aaaggaaaga atagtcgcca tactcgagtg ggatcgctca aatctacccg
551 agcaccgttt ggaagccatt tgtgcggcaa tggtcgaagc gtggggctat
601 ccagatctca tacatgaaat ccggaaattt tatgcatggc ttctggaaat
651 gcaaccattt gcaaatctag ccaaagaggg tttagctcca tacattgcag
701 aaacagcgct tcgtaacctg tatctaggct cagggatcaa ggaagaggaa
751 atcgaaaaat acttcaagca gtttgcaaag gacctccctg ggtatttaga
801 ggactacaac gaagaagttt tccaccaagc tggaacagtc gatgcaggcg
851 ctcaaggagg aggtggaaac gctggaactc aaccgccagc caccggagca
901 gcagttcaag gaggagctca accaccagca actggagcag ctgcgcaacc
951 acctgcggct cagcccacag ggggagctac tggaggaggt agtgcacaaa
1001 caggagctgg tggaactggc tcaattacag gaggccaaag agacaaggat
1051 gtagatgctg gtacgacagg caaaatcaca gtgccaaaac ttaaagccat
1101 gtcgaagaag atgcgcttac caaaagcaaa aggaaaggac gttttacacc
1151 tggactttct gttaacatac aaaccgcaac aacaagacat atcaaacaca
1201 agagcaacca gagaggagtt tgataggtgg tatgaagcca taaagaagga
1251 atatgaaata gatgacacac aaatgacagt tgtcatgagt ggtctaatgg
1301 tatggtgtat tgaaaatggt tgctcaccaa acataaacga aagttggaca
1351 atgatggatg gagatgaaca aagagtcttc ccattgaaac cagttattga
1401 aaacgcatct ccaacattcc ggcaaataat gcatcatttc agtgatgcag
1451 ctgaagcata tatcgagtat agaaattcta cagagcgata catgccacga
1501 tatggacttc agcgaaatct caccgactat agcttagcgc ggtatgcatt
1551 cgacttttac gaaatgaatt caagaacacc agctagagct aaggaagccc
1601 acatgcagat gaaggccgta gcagtccgtg gttcaaacac acgattgttc
1651 ggtctggacg gaaatgtcgg cgagacccag gagaatacag agagacacac
1701 agctggcgat gtcagtcgta acatgcactc tctgttggga gtgcagcagc
1751 accactagtt tcctggaaac cctgtttgca gtacctatag tatgtactaa
1801 taatgtgtat cagtgaggtt ctacctcgtc tctactatat tacgtatgta
1851 cttaaagcgt gaaccagtct gcaggacaca gggttggacc cagtgtcttc
1901 tggtgtagcg tgtactagcg tcgagccacg tgacggacag cgctgggtgt
1951 ggctttgcca ttggtgctgc gagtctcttg gtgagagac