Sequence of DPV Sugarcane mosaic virus

Sugarcane mosaic virus strain B polyprotein mRNA, partial cds.

ACC No: U57355

Dated: 2006-11-14 | Length: 1989 | CRC: -615398758

                
ID   U57355; SV 1; linear; mRNA; STD; VRL; 1989 BP.
XX
AC   U57355;
XX
DT   06-FEB-1997 (Rel. 50, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Sugarcane mosaic virus strain B polyprotein mRNA, partial cds.
XX
KW   .
XX
OS   Sugarcane mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Potyvirus.
XX
RN   [1]
RP   1-1989
RA   Mirkov T.E., Yang Z.N.;
RT   "Sequence and relationships of Sugarcane Mosaic and Sorghum Mosaic Virus
RT   strains, and development of RT-PCR based RFLPs for strain discrimination";
RL   Phytopathology 87:932-939(1997).
XX
RN   [2]
RP   1-1989
RA   Mirkov T.E.;
RT   ;
RL   Submitted (02-MAY-1996) to the EMBL/GenBank/DDBJ databases.
RL   T. Erik Mirkov, Plant Pathology, Texas A&M, 2415 E. Hwy 83, Weslaco, TX
RL   78596, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1989
FT                   /organism="Sugarcane mosaic virus"
FT                   /strain="B"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:12224"
FT   mat_peptide     <1. .828
FT                   /product="nuclear inclusion II protein"
FT   CDS             <1. .1758
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:P89205"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:P89205"
FT                   /protein_id="AAB70859.1"
FT                   /translation="CDADGSQFDSSLTPYLINAVLHIRLQFMEEWELGAQMLRNLYTEI
FT                   VYTPIATPDGSIIKKFKGNNSGQPSTVVDNTLMVILAFNYAMLSSGIQDNEIDNCCKMF
FT                   ANGDDLLLAVHPDYEHILDGFQTHFGNLGLNFEFNSRTKEKSNLWFMSTQGLKCEGIYI
FT                   PKLEKERIVAILEWDRSNLPEHRLEAICAAMVEAWGYPDLIHEIRKFYAWLLEMQPFAN
FT                   LAKEGLAPYIAETALRNLYLGSGIKEEEIEKYFKQFAKDLPGYLEDYNEEVFHQAGTVD
FT                   AGAQGGGGNAGTQPPATGAAVQGGAQPPATGAAAQPPAAQPTGGATGGGSAQTGAGGTG
FT                   SITGGQRDKDVDAGTTGKITVPKLKAMSKKMRLPKAKGKDVLHLDFLLTYKPQQQDISN
FT                   TRATREEFDRWYEAIKKEYEIDDTQMTVVMSGLMVWCIENGCSPNINESWTMMDGDEQR
FT                   VFPLKPVIENASPTFRQIMHHFSDAAEAYIEYRNSTERYMPRYGLQRNLTDYSLARYAF
FT                   DFYEMNSRTPARAKEAHMQMKAVAVRGSNTRLFGLDGNVGETQENTERHTAGDVSRNMH
FT                   SLLGVQQHH"
FT   variation       3
FT                   /replace="t"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       6
FT                   /replace="t"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       9
FT                   /replace="t"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       15
FT                   /replace="t"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       72
FT                   /replace="a"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       99
FT                   /replace="g"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       144
FT                   /replace="g"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       576
FT                   /replace="a"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       753
FT                   /replace="t"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   mat_peptide     829. .1755
FT                   /product="coat protein"
FT   variation       905
FT                   /replace="c"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain; results in amino acid change from V to A"
FT   variation       991
FT                   /replace="g"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain; results in amino acid change from S to G"
FT   variation       1340
FT                   /replace="g"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain; results in amino acid change from E to G"
FT   variation       1465
FT                   /replace="a"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain; results in amino acid change from E to K"
FT   variation       1487
FT                   /replace="a"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain; results in amino acid change from R to Q"
FT   variation       1619
FT                   /replace="c"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain; results in amino acid change from V to A"
FT   3'UTR           1759. .1989
FT   variation       1942
FT                   /replace="a"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
FT   variation       1950
FT                   /replace="c"
FT                   /note="nucleotide difference between two independent clones
FT                   for this strain"
XX
SQ   Sequence 1989 BP; 633 A; 423 C; 482 G; 451 T; 0 other;

u57355 Length: 1989  14-NOV-2006  Type: N  Check: 488  ..

       1  tgcgacgcgg atggctcaca atttgacagc tccttaacac catatctcat
      51  aaatgccgtg ctacacattc ggttacaatt tatggaggag tgggaattag
     101  gcgcacaaat gttacgaaat ctgtacactg agatcgtcta cacaccaatt
     151  gcaacaccag atggttccat aatcaagaaa tttaaaggaa acaacagtgg
     201  tcaaccatca actgtagtcg acaacacgct aatggtcatc ttagcattca
     251  attatgcaat gttgtcaagt ggaatacaag acaatgaaat tgacaactgt
     301  tgcaaaatgt ttgctaatgg agatgatcta ctgttggcag tacatcccga
     351  ttatgaacat atactggatg gctttcagac ccactttgga aaccttggtt
     401  taaattttga attcaattca cgaacgaagg aaaaatcgaa tttgtggttc
     451  atgtcaacac agggactcaa gtgtgagggc atttacatac caaaactcga
     501  aaaggaaaga atagtcgcca tactcgagtg ggatcgctca aatctacccg
     551  agcaccgttt ggaagccatt tgtgcggcaa tggtcgaagc gtggggctat
     601  ccagatctca tacatgaaat ccggaaattt tatgcatggc ttctggaaat
     651  gcaaccattt gcaaatctag ccaaagaggg tttagctcca tacattgcag
     701  aaacagcgct tcgtaacctg tatctaggct cagggatcaa ggaagaggaa
     751  atcgaaaaat acttcaagca gtttgcaaag gacctccctg ggtatttaga
     801  ggactacaac gaagaagttt tccaccaagc tggaacagtc gatgcaggcg
     851  ctcaaggagg aggtggaaac gctggaactc aaccgccagc caccggagca
     901  gcagttcaag gaggagctca accaccagca actggagcag ctgcgcaacc
     951  acctgcggct cagcccacag ggggagctac tggaggaggt agtgcacaaa
    1001  caggagctgg tggaactggc tcaattacag gaggccaaag agacaaggat
    1051  gtagatgctg gtacgacagg caaaatcaca gtgccaaaac ttaaagccat
    1101  gtcgaagaag atgcgcttac caaaagcaaa aggaaaggac gttttacacc
    1151  tggactttct gttaacatac aaaccgcaac aacaagacat atcaaacaca
    1201  agagcaacca gagaggagtt tgataggtgg tatgaagcca taaagaagga
    1251  atatgaaata gatgacacac aaatgacagt tgtcatgagt ggtctaatgg
    1301  tatggtgtat tgaaaatggt tgctcaccaa acataaacga aagttggaca
    1351  atgatggatg gagatgaaca aagagtcttc ccattgaaac cagttattga
    1401  aaacgcatct ccaacattcc ggcaaataat gcatcatttc agtgatgcag
    1451  ctgaagcata tatcgagtat agaaattcta cagagcgata catgccacga
    1501  tatggacttc agcgaaatct caccgactat agcttagcgc ggtatgcatt
    1551  cgacttttac gaaatgaatt caagaacacc agctagagct aaggaagccc
    1601  acatgcagat gaaggccgta gcagtccgtg gttcaaacac acgattgttc
    1651  ggtctggacg gaaatgtcgg cgagacccag gagaatacag agagacacac
    1701  agctggcgat gtcagtcgta acatgcactc tctgttggga gtgcagcagc
    1751  accactagtt tcctggaaac cctgtttgca gtacctatag tatgtactaa
    1801  taatgtgtat cagtgaggtt ctacctcgtc tctactatat tacgtatgta
    1851  cttaaagcgt gaaccagtct gcaggacaca gggttggacc cagtgtcttc
    1901  tggtgtagcg tgtactagcg tcgagccacg tgacggacag cgctgggtgt
    1951  ggctttgcca ttggtgctgc gagtctcttg gtgagagac