Sequence of DPV Saguaro cactus virus

Saguaro cactus virus, complete genome.

ACC No: U72332

Dated: 2005-04-18 | Length: 3879 | CRC: 1638779116

                !!NA_SEQUENCE 1.0
ID   SCU72332   standard; genomic RNA; VRL; 3879 BP.
XX
AC   U72332;
XX
SV   U72332.1
XX
DT   06-DEC-1996 (Rel. 50, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Saguaro cactus virus, complete genome.
XX
KW   .
XX
OS   Saguaro cactus virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3879
RA   Xiong Z., Weng Z.;
RT   "Genome Organization and Gene Expression of Saguaro Cactus Carmovirus";
RL   J. Gen. Virol. 0:0-0(1996).
XX
RN   [2]
RP   1-3879
RA   Xiong Z., Weng Z.;
RT   ;
RL   Submitted (23-SEP-1996) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, University of Arizona, Forbes 204, Tucson,
RL   AZ 85721, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3879
FT                   /db_xref="taxon:52274"
FT                   /mol_type="genomic RNA"
FT                   /organism="Saguaro cactus virus"
FT   5'UTR           1. .39
FT   CDS             40. .2307
FT                   /codon_start=1
FT                   /db_xref="GOA:P89107"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:P89107"
FT                   /evidence=EXPERIMENTAL
FT                   /note="translation product of terminator readthrough at UAG
FT                   terminator of SCVP26 ORF"
FT                   /transl_except=(pos:751. .753,aa:OTHER)
FT                   /gene="SCVP86"
FT                   /function="RNA-dependent RNA polymerase"
FT                   /product="SCVP86"
FT                   /protein_id="AAB36710.1"
FT                   /translation="MGILSELLVGTTLTGGLVAVGLAGLQLRIALKTVEVSVDLVRDAY
FT                   EFVVDHTKTRPPLPVREHVLSITREDDPAPELELADCLEKIEDKETDEEGKTKVVRTRT
FT                   TNRHARGSFLRRLIAEAKCHFGGTPTATRANELAAMKFLVGKCRDHHLVVLHTKEVCHA
FT                   AMVGLFTPDDDEIAAMAQLNSHAAYVARVKLHSAVTVDPWWVKILRSGERTAGWQQLWW
FT                   VLWGAPAQRGFTYHKXGGLSYLEGVCTKVWRGTHPNMIEVRRNALVRPRRLYYQQEIGT
FT                   GLQYRVHNASYANLRRGLLERVFYVEDKVNKTLVPCPEPDRNAFKELAYLKRRLVRIVG
FT                   LHTRISAAQVVDCYQGRKRTVYHNARLSLDEIPLDRRDSHLRTFTKAEKFCVDLKPDPA
FT                   PRVIQPRSPRYNLQVARYLKKTEHHIYRGLDKIWGGPCVMKGYNVEEVASHIIGAWEQF
FT                   QKPVAIGFDMSRFDQHVSVPALQFEHSIYQAIFKGDRELQQLLSWQLRNYGTGFAHDGL
FT                   IRYKVDGCRMSGDMNTALGNCILACLITKHICRGLDARLINNGDDCVLICETRDVGRVV
FT                   DKLTTAWLHFGFTCIAEEPVYEPEKIRFCQMAPVYDGEKWVMVRDPKVSLSKDAFSMVR
FT                   WDTVKNAQQWFKAVGQCGLSIAGGVPIVQEFYRMYERAGGHVKLPVLKEVSASGLFHMS
FT                   FNSNRAYSEISDAARFSFWKAFDILPDVQEATEAELRRTWISLDFGPAGDLNNPILEWT
FT                   FL"
FT   CDS             40. .753
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:P90337"
FT                   /gene="SCVP26"
FT                   /product="replication-related protein"
FT                   /protein_id="AAB36707.1"
FT                   /translation="MGILSELLVGTTLTGGLVAVGLAGLQLRIALKTVEVSVDLVRDAY
FT                   EFVVDHTKTRPPLPVREHVLSITREDDPAPELELADCLEKIEDKETDEEGKTKVVRTRT
FT                   TNRHARGSFLRRLIAEAKCHFGGTPTATRANELAAMKFLVGKCRDHHLVVLHTKEVCHA
FT                   AMVGLFTPDDDEIAAMAQLNSHAAYVARVKLHSAVTVDPWWVKILRSGERTAGWQQLWW
FT                   VLWGAPAQRGFTYHK"
FT   CDS             814. .2307
FT                   /codon_start=1
FT                   /db_xref="GOA:P90338"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:P90338"
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="theoretical protein that may be translated by
FT                   initiation at an AUG codon downstream of the SCVP26
FT                   terminator"
FT                   /gene="SCVP57"
FT                   /product="SCVP57"
FT                   /protein_id="AAB36708.1"
FT                   /translation="MIEVRRNALVRPRRLYYQQEIGTGLQYRVHNASYANLRRGLLERV
FT                   FYVEDKVNKTLVPCPEPDRNAFKELAYLKRRLVRIVGLHTRISAAQVVDCYQGRKRTVY
FT                   HNARLSLDEIPLDRRDSHLRTFTKAEKFCVDLKPDPAPRVIQPRSPRYNLQVARYLKKT
FT                   EHHIYRGLDKIWGGPCVMKGYNVEEVASHIIGAWEQFQKPVAIGFDMSRFDQHVSVPAL
FT                   QFEHSIYQAIFKGDRELQQLLSWQLRNYGTGFAHDGLIRYKVDGCRMSGDMNTALGNCI
FT                   LACLITKHICRGLDARLINNGDDCVLICETRDVGRVVDKLTTAWLHFGFTCIAEEPVYE
FT                   PEKIRFCQMAPVYDGEKWVMVRDPKVSLSKDAFSMVRWDTVKNAQQWFKAVGQCGLSIA
FT                   GGVPIVQEFYRMYERAGGHVKLPVLKEVSASGLFHMSFNSNRAYSEISDAARFSFWKAF
FT                   DILPDVQEATEAELRRTWISLDFGPAGDLNNPILEWTFL"
FT   CDS             1460. .1621
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:P89108"
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /product="unknown1"
FT                   /gene="SCVP57"
FT                   /protein_id="AAB36712.1"
FT                   /translation="MFLCPRYNLSTLSIRXYSKATVSSNNYYHGSCAIMVLDLPMTGLS
FT                   GIRLTAVE"
FT   misc_RNA        2266. .3879
FT                   /evidence=EXPERIMENTAL
FT                   /note="sg1; for gene expression of SCVP6 and SCVP9 ORFs"
FT                   /product="large subgenomic RNA"
FT   CDS             2292. .2471
FT                   /codon_start=1
FT                   /db_xref="GOA:P89109"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:P89109"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="SCVP6"
FT                   /product="SCVP6"
FT                   /protein_id="AAB36709.1"
FT                   /translation="MDVPVDTELMVKPAGKRGKTKAKVDIAKDAVRKQAPSTTNGGNWV
FT                   VVADKVEVHIAFNF"
FT   CDS             2377. .2631
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:P89110"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="SCVP9"
FT                   /product="SCVP9"
FT                   /protein_id="AAB36711.1"
FT                   /translation="MLCGNKHLALLMGVIGLLLLIRWRFILPSTFSLPPLVTLEQIIVL
FT                   SFCGLLISCACKADTTLVWHYSDNNSKNQHITISTPNGR"
FT   misc_RNA        2483. .3879
FT                   /evidence=EXPERIMENTAL
FT                   /note="sg2; for gene expression of SCVCP ORF"
FT                   /product="small subgenomic RNA"
FT   CDS             2621. .3655
FT                   /codon_start=1
FT                   /db_xref="GOA:P89111"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:P89111"
FT                   /gene="SCVCP"
FT                   /product="capsid protein"
FT                   /protein_id="AAB36706.1"
FT                   /translation="MDAKYGKDPRLAAAAATGAAWAVRFLNRGWASLSPKQKRTARSVL
FT                   GLQNQPDVIVPVRPRATARVARPTRQGPGLAGKSMTITKCEYLSDIVSHVGTIPLTDHW
FT                   VVNPGTIKTFPQTSLMASQFNKYRLTALRVRYTSTCSFETSGRVAIAFTNDSNDPLPTT
FT                   KSQLYNFPVHIEAAATESKVLTIPCDNVYRFVRDDGVSDPKLVDFGRIVVCTYGSSAAD
FT                   PATLGELFIEYTIVFSDPTYTSSLTQQGENQRSIGPRYATVDYESTRWECQLQAAGRWL
FT                   VCWVSDSAIPSPSIVGVGAKGKVLTSSDSKCGIATVIAQAPYCSIVSTTVSAPSSLTWF
FT                   VARL"
FT   CDS             2634. .2861
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:P89112"
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /product="unknown2"
FT                   /gene="SCVCP"
FT                   /protein_id="AAB36713.1"
FT                   /translation="MGRIRAWLLLLLLVQLGQCVFLIGVGLRSPRNRSAPLDLCWGCRI
FT                   SLMLSCLYDLVLLLVSPGPLGRVPGLRGNP"
FT   3'UTR           3656. .3879
XX
SQ   Sequence 3879 BP; 898 A; 916 C; 1080 G; 980 T; 5 other;

   U72332  Length: 3879  May 10, 2005 10:09  Type: N  Check: 6585  ..

       1  gggtaagctg ctgaatgctt atctctggtt gctctcacca tgggaatcct
      51  aagtgaactg ctcgttggaa ccaccttaac aggtgggtta gttgcagtgg
     101  ggctggcagg cctgcaattg cgcattgccc taaagactgt ggaagtttcc
     151  gttgacctgg tgcgggacgc gtatgaattt gtagttgacc acacaaaaac
     201  gcgcccgcca ctgccggtaa gagagcatgt cctcagcata acacgtgagg
     251  acgatcccgc tccagagctc gaattagctg actgcctcga gaagatcgag
     301  gacaaggaga cggatgagga gggcaagaca aaggtggtgc gcactcgcac
     351  caccaaccgt catgcccgtg gctcgttttt gcgccggttg attgcggagg
     401  ctaagtgcca ctttggtggc acgcctaccg ctacccgcgc caacgagctt
     451  gctgccatga agttcttggt tggcaagtgc cgagatcacc atctggttgt
     501  gctgcacaca aaggaagtat gtcatgcagc gatggttggt ctcttcaccc
     551  ccgatgatga tgagatagca gcaatggctc aactcaatag ccacgctgct
     601  tatgttgctc gggtgaagct ccattctgcg gttactgttg acccttggtg
     651  ggtcaagata ttgaggagtg gagaacgcac tgctggctgg cagcagttgt
     701  ggtgggtgtt atggggagcc cctgctcaac ggggcttcac ctaccacaaa
     751  taggggggcc tatcttacct cgagggtgtg tgtacaaaag tttggagggg
     801  gacacaccct aacatgatcg aggtcagaag gaacgccctc gtgagaccta
     851  ggagacttta ctaccagcaa gagattggca ctggattgca gtatcgtgtg
     901  cacaacgcta gttatgccaa tctcagacgg ggtttgctgg aaagggtctt
     951  ctacgtggaa gataaggtca acaaaaccct ggttccgtgt cccgaacccg
    1001  accgcaatgc attcaaggaa ttggcatatt taaagcggcg gcttgtgcgt
    1051  atcgttgggc tgcatacccg gatctccgct gcgcaagtgg tggattgtta
    1101  tcagggcagg aagcgcaccg tgtatcacaa tgctcgctta tctcttgatg
    1151  aaattcctct tgaycgtcgg gattcccatc ttcgcacttt yacgaaggcg
    1201  gagaartttt gtgttgattt raaaccggac cctgcaccac gtgtcattca
    1251  gccccgatct cctcgttata atttgcaagt tgctcgttac ctcaagaaga
    1301  ctgagcacca catttacagg ggattggata agatttgggg gggtccgtgt
    1351  gttatgaaag ggtataatgt cgaggaagtc gccagtcaca tcatcggtgc
    1401  gtgggaacaa ttccagaagc ctgttgctat tggttttgac atgagcagat
    1451  ttgaccaaca tgtttctgtg cccgcgctac aatttgagca ctctatctat
    1501  caggcratat tcaaaggcga ccgtgagctc caacaattat tatcatggca
    1551  gttgcgcaat tatggtactg gatttgccca tgacgggctt atccggtata
    1601  aggttgacgg ctgtagaatg agcggcgata tgaacactgc cttaggaaat
    1651  tgcatcttag cctgccttat caccaagcac atttgccgtg ggttagacgc
    1701  gagacttatc aacaatggtg acgattgtgt tctcatatgc gaaactcgtg
    1751  acgtggggcg tgtcgtggat aagttaacga cagcgtggct ccactttggt
    1801  tttacatgta tcgcagagga accagtctat gaaccagaga agattaggtt
    1851  ttgtcagatg gcccctgtat atgatggtga gaagtgggtg atggtgcgag
    1901  atccgaaggt cagcctaagt aaggacgctt tttctatggt tcgttgggat
    1951  acagtgaaga atgcacaaca atggtttaaa gctgtggggc agtgcggtct
    2001  atctatagcc ggaggggtgc ctattgtgca ggagttctac aggatgtacg
    2051  agcgcgcggg aggtcatgtc aaactcccag tgttgaaaga ggttagcgct
    2101  agtgggttgt ttcatatgag tttcaattcc aaccgggcct attctgagat
    2151  ttccgatgct gccagattta gcttttggaa agccttcgac atcttaccag
    2201  atgttcagga ggccaccgaa gctgaactgc gtcgcacctg gattagtctc
    2251  gattttggcc cggctggtga ccttaacaac cctatcctag aatggacgtt
    2301  cctgtagaca ctgaactgat ggtgaaacca gccgggaaga gggggaaaac
    2351  aaaagctaaa gtggacatag ccaaggatgc tgtgcggaaa caagcaccta
    2401  gcactactaa tgggggtaat tgggttgttg ttgctgataa ggtggaggtt
    2451  catattgcct tcaactttta gtttgccccc actggtaacg ctagaacaaa
    2501  tcatcgtact tagcttttgt ggtctcttaa tttcctgcgc ttgtaaggca
    2551  gatacaacgc tggtttggca ctattccgac aacaattcaa agaatcaaca
    2601  catcacaatc tccacaccta atggacgcta agtatgggaa ggatccgcgc
    2651  ctggctgctg ctgctgctac tggtgcagct tgggcagtgc gttttcttaa
    2701  taggggttgg gcttcgctct ccccgaaaca gaagcgcacc gctcgatctg
    2751  tgctggggtt gcagaatcag cctgatgtta tcgtgcctgt acgacctcgt
    2801  gctactgctc gtgtcgccag gcccactagg cagggtcccg ggcttgcggg
    2851  gaaatccatg acaattacca agtgcgaata cctttctgac attgtctctc
    2901  acgtgggtac tattccacta accgaccatt gggtggtcaa tcctggcacc
    2951  attaagactt ttccccagac tagcctcatg gcttcgcagt tcaacaagta
    3001  taggttgact gccctgaggg tgcgctatac tagcacctgt agctttgaga
    3051  cgtctgggcg tgtggcaatc gcgttcacta acgatagtaa tgatccactg
    3101  cccaccacca agtcgcagct gtacaacttc cctgtacata tcgaggcagc
    3151  tgcgaccgag tctaaggtgc tgaccatccc gtgcgataac gtttatcggt
    3201  ttgtgaggga cgatggggta tccgatccta aactcgtgga tttcggaaga
    3251  attgtagtgt gcacgtatgg atcgagcgct gcggacccag cgactctagg
    3301  cgaactcttt attgagtaca cgatcgtctt ctctgatcca acctacactt
    3351  cttctctcac acagcaaggt gagaatcagc gcagtattgg tccacgctac
    3401  gccacagtag actacgagtc cacccgctgg gagtgtcaac tacaagcagc
    3451  tggtcgatgg ttggtctgct gggtaagtga tagcgccatc ccttcccctt
    3501  cgatcgtggg ggtaggagct aagggtaagg tgctaacgag ttctgactca
    3551  aagtgcggga ttgcaaccgt tattgctcaa gctccgtact gttccattgt
    3601  ttctactact gtatcggccc cgtcaagctt gacgtggttt gttgctcgac
    3651  tgtgagggga cctacccact gtgctgccac acaggaactt ccaaccttcg
    3701  ggtggcgagg tagggcagaa gagtgactga acgaggatgg tgtagagcaa
    3751  tggatggggg gggagtccat ggtgggctcc ggcgcgacga tgctaaaatc
    3801  tccatatcat gtgtggagtg ggctgcttag tcgcttatta gttgaaaatt
    3851  aggggggtcc ttagggacct ctcccgccc