Sequence of DPV Carnation mottle virus

Carnation mottle virus (CarMV) complete genomic RNA sequence

ACC No: X02986

Dated: 2005-04-18 | Length: 4003 | CRC: 680033538

                !!NA_SEQUENCE 1.0
ID   XXCARMV    standard; genomic RNA; VRL; 4003 BP.
XX
AC   X02986;
XX
SV   X02986.1
XX
DT   28-JAN-1986 (Rel. 08, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Carnation mottle virus (CarMV) complete genomic RNA sequence
XX
KW   coat protein; genome.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4003
RX   MEDLINE; 86041863.
RX   PUBMED; 3840587.
RA   Guilley H., Carrington J.C., Balazs E., Jonard G., Richards K.,
RA   Morris T.J.;
RT   "Nucleotide sequence and genome organization of carnation mottle virus
RT   RNA";
RL   Nucleic Acids Res. 13(18):6663-6677(1985).
XX
CC   Parts of the sequence near the 5' end (bp 22-60, 237-332, 336-357)
CC   were characterized both with cloned cDNA and by direct sequence
CC   analysis of primer elongated cDNA.
CC   To produce the in vitro translation product p77-80 the
CC   UAG-stop codon (pos. 805-807) has to be read through.
XX
CC   Data kindly reviewed (03-MAR-1986) by K. Richards
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4003
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT   CDS             70. .2679
FT                   /db_xref="GOA:Q9WJD9"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9WJD9"
FT                   /note="pot. unidentified reading frame"
FT                   /note="putative readthrough stop-codon"
FT                   /transl_except=(pos:805. .807,aa:OTHER)
FT                   /transl_except=(pos:2359. .2361,aa:OTHER)
FT                   /protein_id="CAB38330.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLVVQSPYGNPNQGLIRGEDEEIDNVEESTPVELTPLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGIKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPLKERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKELVSCPQPEPGSFKEMGYLRRR
FT                   FHRVCGNHTRISANDLVDCYQGRKRTIYENAAASLLDRAIERKDGDLKTFIKAEKFNVN
FT                   LKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHIW
FT                   SAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGVG
FT                   FASNGMLRYTKEGCRMSGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERTD
FT                   IDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKDS
FT                   HSLVHWNNETNAKQWLKSVGMCGLRIAGGVPVVQEFYQKYVETAGNVRENKNITEKSSS
FT                   GFFMMADRAKRGYSAVSEVCRFSFYQAFGITPDQQIALEGEIRSLTINTNVGPQCEAAD
FT                   SLWILNRKYQXLESKCSLGIEENKRHVDRWPRMPSANLHLIVLTGVIGLMLLIRLRCTF
FT                   TSTFSLPPLVTLNQIIALSFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             70. .2361
FT                   /db_xref="GOA:Q9WJE0"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9WJE0"
FT                   /note="putative readthrough stop-codon"
FT                   /transl_except=(pos:805. .807,aa:OTHER)
FT                   /product="put. p77-80 protein (aa 1-763)"
FT                   /protein_id="CAB38331.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLVVQSPYGNPNQGLIRGEDEEIDNVEESTPVELTPLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGIKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPLKERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKELVSCPQPEPGSFKEMGYLRRR
FT                   FHRVCGNHTRISANDLVDCYQGRKRTIYENAAASLLDRAIERKDGDLKTFIKAEKFNVN
FT                   LKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHIW
FT                   SAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGVG
FT                   FASNGMLRYTKEGCRMSGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERTD
FT                   IDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKDS
FT                   HSLVHWNNETNAKQWLKSVGMCGLRIAGGVPVVQEFYQKYVETAGNVRENKNITEKSSS
FT                   GFFMMADRAKRGYSAVSEVCRFSFYQAFGITPDQQIALEGEIRSLTINTNVGPQCEAAD
FT                   SLWILNRKYQ"
FT   CDS             70. .807
FT                   /db_xref="GOA:P04518"
FT                   /db_xref="UniProt/Swiss-Prot:P04518"
FT                   /note="put. p30-34 protein (aa 1-245)"
FT                   /protein_id="CAA26726.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLVVQSPYGNPNQGLIRGEDEEIDNVEESTPVELTPLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGIKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPK"
FT   CDS             2334. .2519
FT                   /db_xref="GOA:P11794"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/Swiss-Prot:P11794"
FT                   /note="unidentified reading frame"
FT                   /protein_id="CAA26727.1"
FT                   /translation="MDIESEVPVVGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             2669. .3715
FT                   /db_xref="GOA:P04383"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/Swiss-Prot:P04383"
FT                   /note="put. p38, coat protein (aa 1-348)"
FT                   /protein_id="CAA26728.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
FT   CDS             complement(3178. .3519)
FT                   /db_xref="UniProt/TrEMBL:Q89271"
FT                   /note="unidentified reading frame"
FT                   /protein_id="CAA26729.1"
FT                   /translation="MHHFPAATTLSCSSLPLTEGTTYVGPSDTLSLLACEILAVLVGSL
FT                   STIVYCINNSPTTVSALSNPYVDKTIRPKSTSLASSLAESLMNRVLPSTGITRSLAVCA
FT                   AVSTCLPRS"
XX
SQ   Sequence 4003 BP; 1127 A; 863 C; 1091 G; 922 T; 0 other;

   X02986  Length: 4003  May 10, 2005 10:09  Type: N  Check: 2529  ..

       1  gggtaagctg gcgggcaaac ctacactcta tcttacatac attatatatt
      51  ctaaccatct gctttcacta tgggattacc cagtctacta gtggaaggcg
     101  ttattggatg cactctagtt ggtggtttgg tggctgttgg tagcgcagcg
     151  ctggccgttc gggcgaccat cggtgtagtg gaattcaata gggagtgtgt
     201  gcgcggggcg agaaggatcg tatctagcgg agggaggtgc ttagtagtcc
     251  aatcccctta tggcaatcct aaccaaggat tgataagggg tgaagacgaa
     301  gaaattgata acgtggagga gtcaactccg gtagagttga ctccgttgat
     351  cgaggttaag gcggaagtgg atgggaaaga ggtggttgtc tctaagaagc
     401  gcgtggtaaa caggcacttg agacaacgat tcgttcgctc catagccatc
     451  gaagccaaaa accactttgg cggtgatatc agcccaagca aggccaatta
     501  cctttctgtt tccaagtttc taacggggaa atgcaaggag aggcatgttg
     551  tgcccgctca cacaagagac tgtgtgagcg ctgccatggt gctggtgttc
     601  acccctgacg tccacgagat cagaatgatg gcaggattgg cgtctgacgc
     651  agcgtacgga ataaagatcg cgatggcaag catactgaac aggaaagggt
     701  ggtgttggag gctaatggta aatccattag atagggcaag atggtgggaa
     751  atgtggtgcg ttgtgaacgg gtttgactcc aacaaacccg tcacctttcc
     801  caaatagggg ggcctgttct acctcaatgg tgtggagacg aaaattcgtc
     851  gtggaggcca cccatcagtg attgaggtag acgggcaatg tcctctaaaa
     901  gagagaaaac tctacgtaca gaatgccata accactggtt atgaatacag
     951  ggtccacaac cattcgtacg caaacctcag acgagggctc cttgagagag
    1001  ttttctatgt tgagcgcaac aaggagctag tcagctgtcc gcaacctgaa
    1051  cccggcagct ttaaagagat gggatacctg cgacgcaggt tccatagagt
    1101  gtgtggcaat catacccgga tctctgccaa tgatttggta gattgttatc
    1151  agggcaggaa acgcacaatt tatgagaatg cagcagcgtc cctacttgat
    1201  agagctatcg aaaggaagga tggcgatctc aagaccttta ttaaggcaga
    1251  gaaattcaac gtaaatctga aaagtgatcc tgctcctcgg gttatacagc
    1301  ctaggagccc tcgctacaat gtggagttgg gccggtactt aaagaagtat
    1351  gaacaccatg cttacaaagc cttagacaag atctggggag gaccaacagt
    1401  catgaaagga tacactacag aggaggtagc acagcacatt tggagcgcat
    1451  ggaatcaatt ccagacacct gtagccatag gatttgacat gtcaagattc
    1501  gatcagcatg tgtctgtagc cgcgctcgag ttcgaacatt catgctattt
    1551  ggcctgtttt gaaggggacg ctcatctcgc caacttgctt aagatgcaac
    1601  tggtgaatca tggcgtgggt tttgcgagca atggaatgtt gcgatacaca
    1651  aaggaagggt gcagaatgag cggtgacatg aacactgcct tgggcaactg
    1701  cttgttagct tgccttatca ccaaacactt aatgaaaatc aggagcagac
    1751  tgatcaacaa tggggatgac tgtgtgctta tttgcgaaag aacagacatc
    1801  gactacgtcg tgagtaattt aacgacggga tggagtcgat ttggattcaa
    1851  ttgcatagca gaagagccag tgtacgaaat ggaaaagatc agattctgcc
    1901  agatggcacc ggtgtttgat ggagcaggct ggctgatggt cagggaccct
    1951  ttggtgagca tgagcaagga ttctcactcc ttagtgcatt ggaacaacga
    2001  aacgaatgca aaacaatggc tgaagtcagt aggaatgtgc ggtctgcgga
    2051  ttgccggggg ggttccagtt gtgcaagagt tctaccaaaa atacgttgaa
    2101  acagccggaa atgtgagaga gaacaaaaat atcacagaga agagtagttc
    2151  tgggttcttt atgatggcgg atcgcgctaa gcggggctat tctgctgtgt
    2201  ctgaggtgtg ccgatttagc ttctaccagg cattcggcat cacgccagac
    2251  cagcagatcg cgttggaggg tgagatcagg tctctcacta tcaacaccaa
    2301  cgtggggccc cagtgtgaag cggcagattc actatggata ttgaatcgga
    2351  agtaccagta gttggaaagc aaatgctcgc tgggaataga ggaaaacaaa
    2401  agacacgtag atcggtggcc aaggatgcca tccgcaaacc tgcatctgat
    2451  agtactaacg ggggtaattg ggttaatgtt gctgataaga ttgaggtgca
    2501  cattcacttc aacttttagt ttgcccccac tggtaacttt aaatcagata
    2551  atagcgttgt cattttgtgg tcttctatta aacagcatct ctcgggcaga
    2601  aagagcttgc tattacaact actctgttga tagttctaaa caacaacaca
    2651  tttcaataag tacaccaaat ggaaaataaa ggagaaaaga tcgcgatgaa
    2701  tcccactgtg caaacattgg cgcagaaggg ggacaagtta gccgtgaagt
    2751  tggtgacaag agggtgggcc tctctgagta cgaaccagaa gaggagagct
    2801  gaaatgcttg ctggatacac tccagcgatc ctagccttca caccccgacg
    2851  accacggatg acgaaccctc ctccaagaac cagtaggaat tcaccaggac
    2901  aagctggaaa gtccatgacg atgagtaaga ccgaactatt aagcaccgtc
    2951  aaaggtacca cgggtgttat cccaagcttt gaagactggg tcgtttcccc
    3001  ccgaaacgta gccgtcttcc ctcaactctc gctgctggcg acgaacttca
    3051  acaagtaccg cattactgcg ctcactgtga agtactcacc cgcgtgcagc
    3101  ttcgagacca atgggagggt ggctctggga ttcaacgatg acgcttcgga
    3151  cacaccacca accaccaagg ttggatttta cgatctgggc aaacatgtgg
    3201  aaactgctgc acagacagct aaggatctag tgataccagt agacggcaaa
    3251  acccggttca tcagggactc ggctagtgat gatgccaaac tagtcgattt
    3301  tggacgaata gtcttgtcaa catacgggtt tgacaaggct gacactgtgg
    3351  tgggcgaatt gtttatacag tacacgattg tgctgagtga cccaaccaag
    3401  acggccaaaa tttcacaggc aagcaacgat aaggtgtcgg acggaccaac
    3451  gtatgtggtc ccttcggtta atggcaacga gctacaacta agagtggtag
    3501  ccgctgggaa atggtgcatt atagtgcggg gtacggttga gggaggcttc
    3551  accaaaccca cacttattgg gccgggaatc agcggtgatg tggactatga
    3601  aagtgccaga cctatcgccg tttgtgaatt ggtgacacaa atggagggcc
    3651  agatattgaa aatcaccaag acctcagcag aacaaccact ccaatgggtt
    3701  gtttatagga tgtgaatgca atagaaaagt ttgttagaca cacacggcgg
    3751  gacgtgttgc cggagctgcc actccgccca agatggatcg atattaacca
    3801  tctttggcaa cagcgtgcgt ggctaatcga acctagtaat tgcatagcat
    3851  ccgactgtaa cctgttctct gctgaatacg agggtggcct cgtgatccca
    3901  aaccataaaa gaaaccaact tgttggtgga agggcttgga agtaggatca
    3951  accactgttt attaattagg ggtgagagta ttcactgtac tctttccccg
    4001  ccc