Sequence of DPV Hibiscus chlorotic ringspot virus

Hibiscus chlorotic ringspot virus genomic RNA

ACC No: X86448

Dated: 2005-04-18 | Length: 3911 | CRC: 1490820313

                !!NA_SEQUENCE 1.0
ID   HCRVGRNA   standard; genomic RNA; VRL; 3911 BP.
XX
AC   X86448;
XX
SV   X86448.2
XX
DT   17-MAR-2000 (Rel. 63, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Hibiscus chlorotic ringspot virus genomic RNA
XX
KW   coat protein; RNA-dependent RNA polymerase.
XX
OS   Hibiscus chlorotic ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RX   DOI; 10.1128/JVI.74.7.3149-3155.2000.
RX   MEDLINE; 20173705.
RX   PUBMED; 10708431.
RA   Huang M., Koh D.C.Y., Weng L., Chang M.L., Yap Y.K., Zhang Y.K., Wong S.M.;
RT   "Complete nucleotide sequence and genome organization of hibiscus chlorotic
RT   ringspot virus, a new member of the genus Carmovirus: evidence for the
RT   presence and expression of two novel open reading frames.";
RL   J. Virol. 74(7):3149-3155(2000).
XX
RN   [2]
RC   Sequence revised by Dr. Wong S.K. (04-JUN-1999)
RP   1-3911
RA   Weng L.;
RT   ;
RL   Submitted (21-APR-1995) to the EMBL/GenBank/DDBJ databases.
RL   L. Weng, National University of Singapore, Dept. of Botany, Kent Ridge,
RL   Singapore 0511, SINGAPORE
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3911
FT                   /db_xref="taxon:53181"
FT                   /mol_type="genomic RNA"
FT                   /organism="Hibiscus chlorotic ringspot virus"
FT                   /clone="pHCRV-220"
FT                   /cultivar="Hibiscus sp."
FT   CDS             31. .675
FT                   /db_xref="UniProt/TrEMBL:Q9IR84"
FT                   /gene="p28"
FT                   /product="P28 protein"
FT                   /protein_id="CAA60168.1"
FT                   /translation="MLSHAFSIAFETASLGAALCVAPFAAAVEIITHPRIAPRDPCIAE
FT                   ELCMRDELEVADPTDEEPEACLENISGTSSDKKVSKIKRRHRGKFALHAAIAAKLHFGG
FT                   TPTPTRSNELAVRRWLASYCKERRLVDTHAIQAIALATPLVLTPGAAEITERAILNSAV
FT                   FGMRRAALAEASKPTSLTYQMVFEPHRPRTWLRAWRKVVGLPDFQGYSPVK"
FT   CDS             31. .2238
FT                   /db_xref="GOA:Q9IR83"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9IR83"
FT                   /note="amber stop-codon"
FT                   /transl_except=(pos:673. .675,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="CAB81767.1"
FT                   /translation="MLSHAFSIAFETASLGAALCVAPFAAAVEIITHPRIAPRDPCIAE
FT                   ELCMRDELEVADPTDEEPEACLENISGTSSDKKVSKIKRRHRGKFALHAAIAAKLHFGG
FT                   TPTPTRSNELAVRRWLASYCKERRLVDTHAIQAIALATPLVLTPGAAEITERAILNSAV
FT                   FGMRRAALAEASKPTSLTYQMVFEPHRPRTWLRAWRKVVGLPDFQGYSPVKXGCLREIA
FT                   GVDTKIVRGEHQSMAVFPREGISKPRRIFQVCGMGNGTTFGVHNNSLTNLRRGLVERVF
FT                   YVEDACKNLVPTPQPLPGKFQELKYLARRVARIAGHHTPIPREHYPGLYKGRRYQIYAD
FT                   AVNSLASNPVHRRDSFLKTFVKAEKINFSAKPDPAPRVIQPRDPRYNVEVGRYLKPYEH
FT                   HLYRALDVVWKGPTVLKGYTVSEIGSIMHSHWSQFQKPCAVGFDMKRFDQHVSVDALRF
FT                   EHSVYGRSFCSKELDRLLEWQLLNSGVGHANDGYIRYKVDGCRMSGDVNTAMGNCLLAC
FT                   LITKHLLKGIRCRLINNGDDCVLFFNTPDLAAVTERLAHWLDFGFQCVVEEPVYELEEV
FT                   EFCQMKPVFDGEEWVCVRNVHVSVAKDTYSINPWNNECDAGRWIRAIGECGEALTGGIP
FT                   VLNAYYKVFKRAYKAPGRVKESLAFDSGMYRLSQRCSRSFHEPTEEARVSFFKAFGVDP
FT                   MAQMAIEEFYDSMDIELEFAPEGKLDDISLLWLLRNRMIAS"
FT   CDS             41. .670
FT                   /db_xref="UniProt/TrEMBL:Q9IR82"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAB81768.1"
FT                   /translation="MLSQLLSKLLLSVRHYVSHLSPQLLKLSRTPVSLHEILASLKSSV
FT                   CAMSLRLLIPLMRNLKLVWKIFPVLQAIRKCLKSKGDTGVSLLSMRQSQQSYILGALQP
FT                   QRARMSLLCGGGLQVIARKGGWLIHTLYKRSLWPLLWYLRQGPLKSLSERSSIALFSVC
FT                   GGRLSLRPLNRLVSHTKWYLSLIGRGLGSEPGGKWWVSLIFRGTRP"
FT   CDS             2205. .2417
FT                   /db_xref="GOA:Q9IR81"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q9IR81"
FT                   /product="putative movement protein P8"
FT                   /protein_id="CAB81769.1"
FT                   /translation="MASPQSNDSFIELNPHNTGDSKGAGKGNRQAKKEVALQAVHKANK
FT                   HDEAVSGGSFVFVADKVEVTININF"
FT   CDS             2344. .2580
FT                   /db_xref="UniProt/TrEMBL:Q9IR80"
FT                   /product="putative movement protein P9"
FT                   /protein_id="CAB81770.1"
FT                   /translation="MKLFLGVLSFLLLIKLRLPLTLTFDVDLRTLRENCFIITTLSLFG
FT                   FFITVLIKAESEHFHFHTHDSSKTQNIVVNTGK"
FT   CDS             2603. .3277
FT                   /db_xref="UniProt/TrEMBL:Q9IR79"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAB81771.1"
FT                   /translation="MTQPFNVRLMPIYLGQSNLRTMGGLLFLRVKREQPIDTRVEPVLL
FT                   LLKLSCQHLRLQLRWPPRCGLETLEQTLGRLENRSLSSIASLWAISPGRLVVGYWWSRG
FT                   QSTPATYSASPGFLYLLPDMRSTACHHYLFDILQLAPQQRRARSSWHLIKMLQMLPLPP
FT                   RATCITMMEQLESRPGIVPCCKYLAIMWIGLLMIPVVPTLSLLTLVRWLLPIMANLKGM
FT                   WM"
FT   CDS             2590. .3627
FT                   /db_xref="GOA:Q9IR78"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9IR78"
FT                   /product="coat protein"
FT                   /protein_id="CAA60169.2"
FT                   /translation="MLQKNDPAVQRAFNAHLPWAIKLKNDGWAALSKGQKRAANRYAGG
FT                   TRPVTSQIKLSTLKVTAPVAASMRTRNPGANIRTAGKSVTVVHCEFVGNIARQTGSGLL
FT                   VVERTINPSNVLSFPWLSVLAAGYEKYRVSSLSLRYSPTCATTTEGKVILAFDKDAADA
FT                   SPTSKSDMYNHDGAVGVSPWDSAMLQIPCDNVDRFINDSSSSDPKLVDFGKVVVANYGQ
FT                   SEGDVDVIGELFLQYSITLKIPQGMATPTQSGVGISSVGPSLFRVQLRDDTHVFTCNGT
FT                   GRFLFFFNSTVDATSTIAGMEVKQKSSTDDKGETTIMELLATESGGTIAILAATGTLTW
FT                   WACRN"
XX
SQ   Sequence 3911 BP; 975 A; 917 C; 1007 G; 1012 T; 0 other;

   X86448  Length: 3911  May 10, 2005 10:10  Type: N  Check: 9766  ..

       1  gggaaaccgt ggcaagtttc cgaattctct atgctctcac atgctttctc
      51  aattgctttc gaaactgctt ctctcggtgc ggcactatgt gtcgcacctt
     101  tcgccgcagc tgttgaaatt atcacgcacc cccgtatcgc tccacgagat
     151  ccttgcatcg ctgaagagct ctgtatgcgc gatgagcttg aggttgctga
     201  tcccactgat gaggaacctg aagcttgtct ggaaaatatt tccggtactt
     251  caagcgataa gaaagtgtct aaaatcaaaa ggcgacacag gggtaagttt
     301  gctctccatg cggcaatcgc agcaaagcta cattttgggg gcactccaac
     351  cccaacgcgc tcgaatgagc ttgctgtgcg gcggtggctt gcaagttatt
     401  gcaaggaaag gaggttggtt gatacacacg ctatacaagc gatcgctctg
     451  gccactcctc tggtacttac gccaggggcc gctgaaatca ctgagcgagc
     501  gatcctcaat agcgctgttt tcggtatgcg gagggcggct ctcgctgagg
     551  cctctaaacc gactagtctc acataccaaa tggtatttga gcctcatcgg
     601  ccgaggactt ggctcagagc ctggcggaaa gtggtgggtc tccctgattt
     651  tcaggggtac tcgcccgtga aataggggtg ccttagggaa atagctggtg
     701  tggacaccaa aattgtccgt ggagagcacc agtctatggc cgtattccct
     751  agggaaggaa tctccaaacc ccggcgcatc ttccaagtct gtggaatggg
     801  taatgggacc actttcggag ttcacaacaa ttccttaact aatttaagga
     851  gaggtcttgt tgagagagtg ttctacgtgg aagatgcctg caaaaattta
     901  gtcccgaccc ctcagcccct acctgggaag ttccaggagc tgaagtatct
     951  ggctcgacgt gtcgcgcgca ttgctggtca tcatacccct atccccaggg
    1001  aacactaccc tgggttgtat aagggcagga ggtaccaaat ttacgccgat
    1051  gcggtcaaca gtttggcatc taatccggtt caccggagag attcctttct
    1101  gaagactttc gtgaaagctg agaagattaa cttttcagcg aaaccagacc
    1151  cggctcctag agttatccag cctagggatc cgagatataa tgtagaggta
    1201  ggtagatatc ttaagcccta cgaacaccat ctatatagag ctctagatgt
    1251  tgtttggaaa gggcctaccg tgcttaaggg atatactgtc agcgagattg
    1301  gaagtattat gcactcgcat tggtcacaat tccagaaacc atgtgctgtg
    1351  ggttttgaca tgaaacgatt tgatcagcac gtttctgtgg atgcgttgcg
    1401  attcgagcat tctgtgtatg gaaggagttt ttgctctaag gagcttgaca
    1451  gattgctcga gtggcaactc ctcaattccg gggttggaca cgccaatgac
    1501  gggtacatta ggtacaaggt tgatggatgt aggatgagtg gggacgtgaa
    1551  cactgctatg ggtaactgtc tactcgcttg tctcatcacc aaacacttat
    1601  taaaaggcat cagatgtaga ctcatcaaca atggagacga ctgtgtcctc
    1651  ttcttcaaca ctcctgatct agctgcggtc actgaaaggt tggctcactg
    1701  gcttgatttt gggttccagt gtgttgtcga ggaaccagtc tatgaactgg
    1751  aagaagttga gttttgccaa atgaagcccg tgtttgatgg tgaagagtgg
    1801  gtgtgtgtgc gtaatgttca cgtgtcggta gcgaaggata cctactctat
    1851  caacccttgg aataatgagt gtgacgctgg taggtggata cgggctattg
    1901  gggaatgcgg tgaggcactc accgggggca tcccagtgct gaatgcatat
    1951  tacaaggtgt tcaaaagagc gtacaaagca ccaggtaggg tgaaggagag
    2001  ccttgcgttc gattccggta tgtaccggct ctcccaacga tgttctagaa
    2051  gctttcatga accaacagaa gaagccaggg tgagtttctt caaagccttt
    2101  ggggtggacc ctatggctca aatggccatt gaggagtttt atgactccat
    2151  ggacattgag cttgagtttg ccccggaggg aaaacttgat gatatctctc
    2201  tcttatggct tctccgcaat cgaatgatag cttcatagaa cttaatcctc
    2251  acaatactgg tgatagtaag ggcgcaggta aagggaacag acaggcaaag
    2301  aaagaagttg cacttcaagc agtgcacaaa gctaataagc acgatgaagc
    2351  tgtttctggg ggttctttcg tttttgttgc tgataaagtt gaggttacca
    2401  ttaacattaa cttttgacgt ggacttgaga accctccggg aaaattgctt
    2451  tatcataacc acgcttagct tgtttgggtt ctttatcact gtcctgatta
    2501  aggctgaatc agaacacttt cacttccaca cacacgacag tagtaagaca
    2551  caaaatatag tagttaacac tggaaagtaa ccaaccacaa tgctgcagaa
    2601  gaatgaccca gccgttcaac gtgcgtttaa tgcccattta ccttgggcaa
    2651  tcaaacttaa gaacgatggg tgggctgctc tttctaaggg tcaaaagaga
    2701  gcagccaata gatacgcggg tggaacccgt cctgttactt ctcaaattaa
    2751  gctgtcaaca cttaaggtta cagctccggt ggccgcctcg atgcggactc
    2801  gaaaccctgg agcaaacatt aggacggctg gaaaatcggt cactgtcgtc
    2851  cattgcgagt ttgtgggcaa tatcgcccgg cagactggta gtgggctact
    2901  ggtggtcgag aggacaatca accccagcaa cgtactcagc ttcccctggc
    2951  tttctgtact tgctgccgga tatgagaagt accgcgtgtc atcactatct
    3001  cttcgatatt ctccaacttg cgccacaaca acggagggca aggtcatctt
    3051  ggcatttgat aaagatgctg cagatgcttc ccctacctcc aagagcgaca
    3101  tgtataacca tgatggagca gttggagtct cgccctggga tagtgccatg
    3151  ctgcaaatac cttgcgataa tgtggatagg tttattaatg attccagtag
    3201  ttccgaccct aagcttgttg actttggtaa ggtggttgtt gccaattatg
    3251  gccaatctga aggggatgtg gatgtgattg gagagctgtt cctgcaatac
    3301  tccatcaccc tcaaaatccc ccaaggtatg gcgacaccta cacagtccgg
    3351  ggtaggcatc tcatcggttg gcccctccct cttccgggtc caacttagag
    3401  atgacacaca tgtgtttacc tgcaacggga ctggtcgctt cttgttcttc
    3451  ttcaactcaa ccgttgatgc aacctccacc atcgctggga tggaggtgaa
    3501  gcagaagagt tcaaccgacg acaaaggaga aacaacgata atggaactac
    3551  tcgctactga atcaggtggt acgatagcaa tattggcggc cacaggcaca
    3601  ctcacttggt gggcctgtag gaactaggtg tgtattgtat gggcctccgt
    3651  gctgttaggg gcagtggaaa cgtcggtcta gccagccgtc ccctgggtag
    3701  tgtgctccgt ctaagtacac cactactcgg tttccacaaa cgatcggact
    3751  cccaaaatag tgtacattat gttgattgct tctttcctcc cttgtaatat
    3801  ctcctctccc ctctcctcta cgcttggaat ccataaaatc cttcgggtgg
    3851  gcttggattt cgggtacttg tttgaaatac cctcacaacc gccatagttg
    3901  tgaggcagcc c