Sequence of DPV Galinsoga mosaic virus

Galinsoga mosaic virus, complete genome

ACC No: Y13463

Dated: 2005-04-18 | Length: 3803 | CRC: -581874024

                !!NA_SEQUENCE 1.0
ID   GMCVCG     standard; genomic RNA; VRL; 3803 BP.
XX
AC   Y13463;
XX
SV   Y13463.1
XX
DT   20-JUN-1997 (Rel. 52, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Galinsoga mosaic virus, complete genome
XX
KW   capsid protein; complete genome; movement protein; replicase.
XX
OS   Galinsoga mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RX   DOI; 10.1007/s007050050277.
RX   MEDLINE; 98166875.
RX   PUBMED; 9505975.
RA   Ciuffreda P., Rubino L., Russo M.;
RT   "Molecular cloning and complete nucleotide sequence of Galinsoga mosaic
RT   carmovirus genomic RNA";
RL   Arch. Virol. 143(1):173-180(1998).
XX
RN   [2]
RP   1-3803
RA   Russo M.;
RT   ;
RL   Submitted (29-MAY-1997) to the EMBL/GenBank/DDBJ databases.
RL   M. Russo, Centro Studi del CNR sui Virus e le Virosi della Colture
RL   Mediterranee, Via Amendola 165/A, I70126 Bari, ITALY
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3803
FT                   /db_xref="taxon:60714"
FT                   /mol_type="genomic RNA"
FT                   /organism="Galinsoga mosaic virus"
FT                   /lab_host="Nicotinana tabacum"
FT   CDS             43. .672
FT                   /db_xref="UniProt/TrEMBL:O12300"
FT                   /note="ORF1"
FT                   /product="replicase"
FT                   /protein_id="CAA73862.1"
FT                   /translation="MGAISKISKISSFVVAGIVAYKVGKATYNAFRYRNQESITAARDL
FT                   QAAVEAVEEQPEFGSVEECLEETPASQSERTTIQNEGDLAKMPVSRKRRIRNRKHGRFV
FT                   SYLVNEAKAEYGLPKPTEAYRLMVGGFLNRLCKEWGVVTSHTHQAVSIALPLVFVPTKF
FT                   DVMGKAMCATTRTNQLIGENSTDQATGWFDNVLGIGGGVGLRFLGK"
FT   CDS             43. .2232
FT                   /db_xref="GOA:O12301"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:O12301"
FT                   /note="readthrough protein"
FT                   /note="ORF2"
FT                   /transl_except=(pos:670. .672,aa:OTHER)
FT                   /product="replicase"
FT                   /protein_id="CAA73863.1"
FT                   /translation="MGAISKISKISSFVVAGIVAYKVGKATYNAFRYRNQESITAARDL
FT                   QAAVEAVEEQPEFGSVEECLEETPASQSERTTIQNEGDLAKMPVSRKRRIRNRKHGRFV
FT                   SYLVNEAKAEYGLPKPTEAYRLMVGGFLNRLCKEWGVVTSHTHQAVSIALPLVFVPTKF
FT                   DVMGKAMCATTRTNQLIGENSTDQATGWFDNVLGIGGGVGLRFLGKXGCLERRLGFSTT
FT                   VSRGSHPDLVVKPSGRPEKQRQLSAIVDSWGRKPLVFTITRLANLRRGMIERMYYVERD
FT                   KNLVEPPAPSVDFRLPHFSSAFKKVIGRHTPVTRQAFVEFYRGRKRTIYEKAVESLSAA
FT                   PVTHRDARLKTFVKAEKLVLSRKPDPAPRIIQPRAPRYNVELGVYLRPFEHKAFRAVER
FT                   VFGSPTIMKGYTAEEQASIAREKWDRFSKPVAIGLDASRFDQHVSVAALKWEHKLYHHA
FT                   FNHDKTLKKLLKWQIHNEGTAFASDGCIKYKKTGCRMSGDMNTSLGNCLIMCGMVYDLL
FT                   VTHDIDAELLNNGDDCVLICERSEEAHLLEVIPQYFRQYGFTMEVEKPVHIFEKLEFCQ
FT                   TQPVYVDGKWIMVRKPNPAMSKDLTCLLPIQNENNFKEWLSAVSECGLALTGGVPLWQN
FT                   FYQACNLGAARTGFTKSGLFTESGLAYASRGLHRRFSEPSAETRHSFYLAFGITPDLQL
FT                   ALEKELDSKIMNEWTMIPRDTRQRTYYSTISNELT"
FT   CDS             2219. .2428
FT                   /db_xref="UniProt/TrEMBL:O12302"
FT                   /note="ORF3"
FT                   /product="movement protein"
FT                   /protein_id="CAA73864.1"
FT                   /translation="MNSHDDGNNSDPSPGNYSRNRGVRNKGMSGVKEQAVGQEIQKQHQ
FT                   GRGNSTMVNVADTQTITVTNNFNF"
FT   CDS             2428. .2604
FT                   /db_xref="UniProt/TrEMBL:O12303"
FT                   /note="ORF4"
FT                   /product="movement protein"
FT                   /protein_id="CAA73860.1"
FT                   /translation="MKYCRCSDTAPTDHITLLFVIFILSGLILSLCTNITSNNYENHTT
FT                   ENKTQWITIGGQQ"
FT   CDS             2546. .3568
FT                   /db_xref="GOA:O12304"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:O12304"
FT                   /note="ORF5"
FT                   /product="capsid protein"
FT                   /protein_id="CAA73861.1"
FT                   /translation="MKTTQPKTKPSGSPLADNNKSYRSNRTNKQKTQDQSAPVAISRQV
FT                   RGSVPKLAGNRPFTFGHRELIATISNTVLFQVNGGVGGNLYRLNPANSSLFTWLPSISA
FT                   NFDQYRFLKVWLEYAPFCSTTEAGRVGLYFDKDSQDPEPTDRVELANFGHLSETVAWSP
FT                   IELHLPTDNVVRYMSDSSVSDPKLIDLGQIGFATYGGGSTNAIGDLFIHYTIELQQPQP
FT                   TYFAVQTLQSGNGSSSAGPTVAAVTASTGTSTTLTFRSPGTYLVNLFQRSLTFTSIVAT
FT                   GGTVINSQATLQSGATAYCSQHNVTVSTPGGALVATGTGFGNYNFQVTRARVQNRCDLL
FT                   "
XX
SQ   Sequence 3803 BP; 1061 A; 876 C; 954 G; 912 T; 0 other;

   Y13463  Length: 3803  May 10, 2005 10:10  Type: N  Check: 9457  ..

       1  ggtaaagacg ccaatctttg ctagtcaacc aaagactata acatgggggc
      51  tatatcgaag atttctaaga ttagttcgtt cgtagtggca ggcattgttg
     101  catataaggt tggtaaagct acatacaatg cttttaggta caggaaccag
     151  gaatctatta cagcagcccg ggacctccaa gcagcagtgg aagctgtgga
     201  agaacaaccg gaattcggta gtgtagaaga atgtcttgag gaaactccag
     251  cttctcaatc tgaaagaacc accattcaga atgaggggga cctagccaaa
     301  atgcctgtca gtcgtaaacg tcgtattcga aacaggaaac acggtcggtt
     351  tgttagctat ctagttaacg aggctaaggc agagtacgga ctacccaaac
     401  caactgaagc atataggcta atggttggtg gatttctcaa tcgattatgt
     451  aaagaatggg gagtggtgac tagccacaca catcaagcgg tttctattgc
     501  cctgccactt gtcttcgttc cgacgaagtt cgacgtgatg gggaaagcta
     551  tgtgtgccac tacccggacg aaccaactca taggggagaa ttccactgat
     601  caagctacag ggtggtttga caatgttctg ggaattggag gcggcgttgg
     651  cctccggttc ctgggcaaat aggggtgcct tgaaaggagg ctagggttct
     701  ctaccacagt ttctcgtggt agtcaccccg atctggtggt caaaccatca
     751  gggcgcccgg agaaacagcg gcagttatcc gctatagtgg actcatgggg
     801  tcgcaaacca ttggtgttca caataactcg tctcgccaac ttgcggaggg
     851  gcatgattga gcgaatgtat tatgtagagc gagacaaaaa tctcgtggaa
     901  cccccagcac ctagtgtgga tttccgtctt ccacacttct cgtctgcgtt
     951  caagaaggta attggtcgtc ataccccggt aactcgacaa gcttttgttg
    1001  aattttatag gggcaggaag agaaccattt acgagaaagc ggtggagagc
    1051  ttgtccgcag ctccagtaac ccaccgagat gcgagactaa agacgtttgt
    1101  caaggcagag aagctggtat tgtcgcgcaa gcccgatcca gctcctcgga
    1151  taatccaacc gagggcgcca cgatataacg ttgagttagg ggtgtatttg
    1201  agaccgttcg aacataaagc gtttagagca gtagaacgcg tattcgggag
    1251  tccaactatc atgaaaggct acacagcaga ggaacaagca tctatagcga
    1301  gagaaaagtg ggatcgcttc tccaaaccgg tggcgattgg tttggatgct
    1351  agtaggttcg accagcatgt ttctgttgcg gctttaaaat gggagcacaa
    1401  attgtaccat catgctttca atcatgataa aactctaaag aagttattaa
    1451  aatggcaaat tcacaatgag ggaaccgctt tcgctagcga tgggtgtatc
    1501  aagtataaga agactgggtg tcgaatgagt ggtgacatga atacaagtct
    1551  cgggaactgt ttgattatgt gcggtatggt ttacgacctc ttggtaacac
    1601  acgatataga cgcagaattg cttaacaacg gtgatgactg tgtactcata
    1651  tgcgagaggt cggaggaagc gcatttacta gaagtcattc cccagtattt
    1701  ccgtcaatac ggttttacaa tggaggtgga aaaacccgtg cacattttcg
    1751  agaagctcga gttttgtcaa actcagccag tctatgtcga tggaaagtgg
    1801  attatggtga ggaaacccaa ccctgctatg agtaaggacc tcacgtgttt
    1851  attgccaatt caaaatgaaa acaacttcaa ggagtggcta agtgcagtta
    1901  gcgagtgtgg gttagcttta acgggtggag tcccgttgtg gcaaaacttc
    1951  taccaagcct gcaacttagg agcggcccgc accggcttca cgaaatctgg
    2001  tctcttcaca gagtccggtt tagcctacgc atcccgtggt ttacacagga
    2051  ggtttagtga acctagtgcg gaaactcgcc attcattcta tcttgctttt
    2101  ggcatcacgc ctgacctcca attggcgttg gagaaagaac tcgacagcaa
    2151  gatcatgaac gagtggacca tgattccccg tgatacgcgc caacgtacct
    2201  actactctac aatcagcaat gaactcacat gatgacggaa acaatagtga
    2251  tccatctccg ggaaattaca gtcgaaatcg gggcgtacga aataagggta
    2301  tgtcaggagt caaagagcaa gccgttggac aagagatcca gaaacagcac
    2351  cagggacgag gtaatagcac aatggtcaat gttgcagata cccaaaccat
    2401  aacggtgaca aacaacttca atttctgatg aagtactgtc ggtgcagtga
    2451  tacggcgcca accgatcata tcactcttct ctttgtaatc ttcatactgt
    2501  caggacttat tttatctctg tgtaccaata taacatcaaa caattatgaa
    2551  aaccacacaa ccgaaaacaa aacccagtgg atcaccattg gcggacaaca
    2601  ataaaagcta tcgttccaat cgaaccaaca agcagaagac acaggaccag
    2651  tcagcacctg ttgccatctc acgccaagtg agggggagcg ttcctaaact
    2701  cgccggcaac agaccgttca catttggcca tcgagaacta atcgccacca
    2751  tatccaatac tgtactcttc caagtgaatg gcggagtggg gggtaatctc
    2801  taccgactta accccgctaa ttcctcccta ttcacctggt tgcctagcat
    2851  atcggcgaac ttcgaccagt acagattctt aaaggtctgg cttgaatatg
    2901  ccccattttg ctcaaccact gaggctggca gggtggggtt gtacttcgac
    2951  aaagactcac aagatcctga gcctactgat cgcgtggaat tagcgaactt
    3001  tggtcatctt agtgagaccg tggcatggtc tcccatcgag ttacatctac
    3051  cgaccgacaa tgtggtgcgg tatatgagcg attcttccgt ttcagatcct
    3101  aagttgatag atctggggca gatcgggttc gccacttatg gtggcggatc
    3151  taccaatgca attggggact tgttcataca ttacaccata gaactgcagc
    3201  aacctcagcc aacctacttt gcagtccaga ctctccaatc tggaaatggc
    3251  tctagtagtg ccggccccac tgtagccgct gtaacggcta gcactggcac
    3301  cagtactact cttacctttc gaagcccggg aacgtatctc gtcaatcttt
    3351  tccagcggtc gcttactttc acgagtatag tggcaactgg agggaccgtt
    3401  ataaattccc aggctaccct gcaatcaggc gcgacggcat actgcagcca
    3451  acataatgta actgtatcaa ctccaggtgg ggcactagtg gcaacgggga
    3501  cgggatttgg aaactataat ttccaggtca ctcgtgctag ggtacaaaac
    3551  aggtgtgatc ttctctagag gaagatgctt gggggtgttc ccctaaagtt
    3601  cagaatggtc tatcagggag caggcacttt tccggctttg gcgagtcgtc
    3651  tccacttgta tacgaacagt gaggggaaaa gttatctgat agaagaatga
    3701  accatggaca aggacactct aaaccaccac taagaagcta tagggaaacc
    3751  ttgctgaggg cagtgagtgg tcgtaccaga acgaatatgg ctttgccccg
    3801  ccc